KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_16140Help
Entry
A3UG_16140        CDS       T02159                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Brite
KEGG Orthology (KO) [BR:enl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A3UG_16140
Enzymes [BR:enl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     A3UG_16140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C GST_N_3 GST_N_2 GST_C_2 GST_C_3 NADH_u_ox_C
Motif
Other DBs
NCBI-ProteinID: AFM60954
LinkDB All DBs
Position
3476562..3477191
Genome map
AA seq 209 aa AA seqDB search
MIDLYYAPTPNGHKITLFLEEAELDYRIIRVDISKGDQFRPLFLAISPNNKIPAIIDNLP
ADGGKPLSLFESGEILLYLAEKTGKLLSGELRERHHTLQWLFWQASGLGPMLGQNHHFTA
YAPQPIPYAIERYQVETQRLYGVLNHRLEKTPWLGGDHYSIADIACWPWVNTHERHRIDL
ASYPAVNNWFERIRTRPATERAMKKIHEI
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacctttactatgcccctactccaaacggccataagatcaccctctttcttgaa
gaagccgagctggattacaggatcattcgcgtggatatcagcaaaggcgatcagttcagg
cctctctttctggccatctcaccaaacaataaaatcccggccatcatcgataacctgcca
gccgatggcggcaaaccgttgagcctgtttgaatccggggagattttgctctatctggcg
gagaaaaccggcaaactgctgagcggtgaactgcgcgaacgtcaccacacgctgcagtgg
ctgttctggcaggcaagcggcctggggccgatgctggggcagaaccatcactttaccgct
tacgctcctcagcctatcccttatgccatagagcgctatcaggtggagacgcagcgcctg
tacggtgtgttgaaccaccggctggagaaaacgccgtggctcggcggcgatcactacagt
atcgccgatatcgcctgctggccgtgggtgaatacccatgaacgccaccgcattgattta
gcgtcttatccggcagtcaacaactggtttgagcgcatccgtacccgcccggcgaccgag
cgtgcaatgaaaaaaatccacgagatttag

DBGET integrated database retrieval system