KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_16295Help
Entry
A3UG_16295        CDS       T02159                                 

Gene name
fadJ
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
enl00071  Fatty acid degradation
enl00280  Valine, leucine and isoleucine degradation
enl00281  Geraniol degradation
enl00310  Lysine degradation
enl00362  Benzoate degradation
enl00380  Tryptophan metabolism
enl00410  beta-Alanine metabolism
enl00640  Propanoate metabolism
enl00650  Butanoate metabolism
enl00903  Limonene and pinene degradation
enl00930  Caprolactam degradation
enl01100  Metabolic pathways
enl01110  Biosynthesis of secondary metabolites
enl01120  Microbial metabolism in diverse environments
enl01130  Biosynthesis of antibiotics
enl01200  Carbon metabolism
enl01212  Fatty acid metabolism
Module
enl_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:enl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    A3UG_16295 (fadJ)
   00650 Butanoate metabolism
    A3UG_16295 (fadJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A3UG_16295 (fadJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A3UG_16295 (fadJ)
   00310 Lysine degradation
    A3UG_16295 (fadJ)
   00380 Tryptophan metabolism
    A3UG_16295 (fadJ)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A3UG_16295 (fadJ)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    A3UG_16295 (fadJ)
   00281 Geraniol degradation
    A3UG_16295 (fadJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A3UG_16295 (fadJ)
   00930 Caprolactam degradation
    A3UG_16295 (fadJ)
Enzymes [BR:enl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     A3UG_16295 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     A3UG_16295 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     A3UG_16295 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DUF362
Motif
Other DBs
NCBI-ProteinID: AFM60985
LinkDB All DBs
Position
complement(3505255..3507402)
Genome map
AA seq 715 aa AA seqDB search
MAMASAFNLTVRLDNVAVITIDVPDEKMNTLKAEFGVQVREMLKQIRENKAIRGLVFISA
KPDNFIAGADINMIARAQSAQEAEDLARQGQQVMAEIHALPIPVIAAIHGACLGGGLELA
LACHSRICTDDAKTVLGLPEVQLGLLPGSGGTQRLPRLVGVSTALEMILTGKQLRARQAL
KAGLVDDVVPHSILLEAAVELALKGRQAKRVLPVRERILAGPLGRTLLFSMVGKKTEQKT
KGNYPAAKRILEVIETGLSQGSSSGYAAEAKAFGELAMTPQSQALRSIFFASTDVKKDPG
SDAEPAPLNAVGVLGGGLMGGGIAFVTASKAKLPVRIKDINPKGINHALQYSWQNLDQKV
KRRHIKASERDKTVAMISGTTDYRGFAHRDLVIEAVFEDLALKQQMVADVEQHCAPHTIF
ASNTSSLPIGDIAAKAARPEQVIGLHFFSPVEKMPLVEVIPHASTSPQTVSTVVKLAKKQ
GKTPIVVADKAGFYVNRILAPYINEAMRLLVEGEKIEHVDEALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLEAAYGERFSPPANIVSAILKDDRKGRKNERGFYLYGAKGRKSKKQVDPS
VYGLIPTTGQAKLSAVQCAERCVMMMLNEAARCFGEQVIKSARDGDIGAVFGIGFPPFLG
GPFRYMDTLGAGEVVAILQRLAAQYGPRFTPCDELLQMAERGQTFWPARETVLVS
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggcaatggcatctgcatttaatttgacggttcgcctcgataacgtggctgtgattacc
attgacgtgcccgatgaaaagatgaataccctgaaggcagaatttggcgttcaggtgcgc
gagatgttaaagcagatccgcgaaaacaaagcgattcgcggactggtatttatctcggcg
aagccagacaactttatagccggggccgatatcaatatgatcgcccgggcgcaaagtgcg
caggaagctgaagatctggcgcgccaggggcagcaggtgatggcggagatccacgctctg
ccgatcccggtgatcgccgcgatccacggtgcatgcctgggcggcgggctggaactggca
ttggcctgccatagccgtatttgtactgacgacgcgaaaaccgttctcgggttgccggaa
gtacagttagggttacttcccgggtccggtgggacgcagcgtctgccgcggctggtgggc
gtcagcacggcgctggagatgatcttaaccggtaaacagctgcgcgcccgtcaggcgctg
aaagcgggactggttgatgacgtcgtcccgcactccattttgctggaagccgccgtggag
ctggcgctgaagggacgtcaggcaaaacgtgttctgccggtgcgtgagcgcatcctggcc
gggccattgggacgaacgttgctgttcagcatggtgggcaagaaaaccgaacaaaagacc
aaaggtaactatccggcggcgaagcgcattcttgaggtgattgaaaccggattgtcgcag
ggcagcagcagcggctatgccgcagaggcaaaagccttcggtgagctggcgatgacaccg
caatcgcaggcgctgcgcagcatcttctttgccagcactgacgttaaaaaagatccgggt
agcgatgctgaaccagcaccgctcaacgccgtgggcgtcctggggggcggattgatgggc
ggcggcattgcgtttgtcactgccagcaaagccaaattgcctgtacgtatcaaagacatc
aacccgaaagggatcaatcacgcgctgcagtacagctggcagaaccttgatcaaaaggtt
aaacgccgccatatcaaggcaagcgagcgggataaaaccgtggccatgatcagcgggacc
accgactaccgtggttttgcccatcgcgatctggtgattgaagcggtgttcgaagatctg
gcgcttaaacagcagatggtcgccgacgttgagcaacattgtgcgccacacaccattttt
gcctcgaacacctcttcattaccgatcggtgatatcgcagcgaaagccgcgcgccctgag
caggtgattggcctgcacttttttagccctgtcgaaaaaatgccgctggtggaggttatt
ccacacgcgtcaaccagcccgcagactgtctctacggtagtgaaactggcgaaaaagcag
gggaaaaccccgatcgtcgtggcggataaagcgggattctacgtcaaccgaattctggcg
ccgtatattaacgaagcgatgcgcctgctggtggaaggggagaagatcgaacacgtcgac
gaggcgctggtcaagtttggtttccccgttggcccaatccaacttttggatgaggtagga
atagacaccggcactaaaattatacctgtgctggaggccgcatatggcgagcgttttagc
ccgcctgcaaacattgtttctgcaattttgaaggacgatcgcaaaggcagaaaaaatgaa
cgcggtttctatctttacggtgcaaaagggcgtaaaagcaagaaacaggtcgacccttcg
gtctatgggcttatcccgacaaccggacaggcgaaactgtctgccgttcagtgtgctgaa
cgctgtgtgatgatgatgcttaatgaagccgcgcgctgttttggcgagcaggtgattaaa
agcgcacgcgatggcgatattggcgccgtatttggtattggtttcccgccgttccttggc
ggcccgttccgttacatggacaccctcggagcgggtgaagtggttgcgattctgcaacgt
cttgccgcgcagtatggtccccggtttacaccctgtgacgaattattgcagatggcggaa
cggggccagacattttggccagcaagggaaactgtcctcgtaagttga

DBGET integrated database retrieval system