KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_21100Help
Entry
A3UG_21100        CDS       T02159                                 

Definition
(GenBank) phosphoglycolate phosphatase
  KO
K01091  phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
enl00630  Glyoxylate and dicarboxylate metabolism
enl01100  Metabolic pathways
enl01110  Biosynthesis of secondary metabolites
enl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:enl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    A3UG_21100
Enzymes [BR:enl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     A3UG_21100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_like Hydrolase_3 Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: AFM61928
LinkDB All DBs
Position
complement(4526348..4527109)
Genome map
AA seq 253 aa AA seqDB search
MDKLQATRGIAFDLDGTLVDSAPGLTSAVDQALYALELPVAGEDRVVTWIGNGADVLMER
ALTWARQERASQRSAQGKPSVDHADIPQEEQLRILRKLFDRFYEETVEEGSFLFPDVAET
LSALHAKGIPLGLVTNKPTPFVAPLLEALDIAKYFTVIVGGDDVQNKKPHPEPLLLVAGK
LSLTPAELLFVGDSRNDILAARAAGCPSVGLTYGYNYGEAITLSEPDVVFDRFKDLLPAL
GLSYSEHQELKND
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggataaattgcaggcaacccggggtattgcatttgacctcgatggcacgctggttgac
agcgcgccgggcttaacgagcgccgtcgaccaggcgctgtacgcccttgaactgcccgtc
gcgggcgaagatcgcgtcgtgacgtggattggtaatggcgcagatgtcctgatggagcgc
gccctgacgtgggctcgccaggagcgtgcgtcacaacgttccgcacagggtaaaccgagc
gttgatcacgcggatatcccgcaggaagaacagctgcgtattctacgcaaactgtttgac
cgtttctacgaagaaaccgttgaagaaggcagcttcctgttcccggatgtcgcggaaacg
ctgagcgcgctgcatgcgaaaggcattccgctggggctggttactaacaagccgacgccg
ttcgttgcgccattgctggaggcgctggatatcgcgaaatacttcaccgtgatagtgggt
ggtgatgacgtacagaataaaaagccgcacccggaaccgctgttgctggtggcaggaaaa
ttatccttaacacctgcggagctgctctttgtcggtgattcacgcaatgatattctggct
gccagagcggcgggttgtccctccgtggggttaacttatggctacaactacggtgaggcc
attaccctgagtgagccggacgtcgtgttcgatcgcttcaaagatttgttgcccgcactc
gggctttcatacagtgaacatcaggaattgaaaaatgactaa

DBGET integrated database retrieval system