KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_22365Help
Entry
A3UG_22365        CDS       T02159                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
enl00620  Pyruvate metabolism
enl00680  Methane metabolism
enl01100  Metabolic pathways
enl01120  Microbial metabolism in diverse environments
enl01200  Carbon metabolism
Module
enl_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:enl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A3UG_22365
  Energy metabolism
   00680 Methane metabolism
    A3UG_22365
Enzymes [BR:enl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     A3UG_22365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AFM62172
LinkDB All DBs
Position
4830636..4833287
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKVLGDTIKDALGENILDRVETIRKLSKSSRAGNEASRQELLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISPNGEAASNPEVIARTLRKLKDQPNLNEA
TIKKAVESLSLELVLTAHPTEITRRTLIHKMVEVNNCLKQLDNKDIADYERNQLMRRLRQ
LIAQSWHTDEIRKHRPSPVDEAKWGFAVVENSLWEGVPNYLRELNEQLEANLGYRLPVDF
VPVRFTSWMGGDRDGNPNVTAEITRHVLLLSRWKATDLFLKDIHVLISELSMVEATPELR
ALAGEEGASEPYRFLMKKLRSQLMATQAWLEARLKGQRLPKPEGLLSQNEQLWEPLYACY
KSLQACGMGIIANGELLDTLRRVKCFGVPLVRIDVRQESTRHTEALGELTRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRNWEPSNETREVLNTCKAIVDAPKGSVAAYVISMAKTP
SDVLGVHLLLKEAGIDYALPVAPLFETLDDLNNANDVMTQLLNIDWYRGFIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTISSLSLYTSAILEANLLPPPEPKASWCHIMDEL
SDISCDLYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQKVVEDGKQSELETMCRDWPFFSTRLGMLEMVFSKADLWLAE
YYDQRLVKPELWALGKELRELLQGDIKVVLDIANDSHLMEDLPWIAESIQLRNIYTDPLN
VLQAELLHRSRLAEEEGKEPDPRVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcgttgcgtagtaatgtcagtatgctcggcaaagtgcttgga
gataccatcaaagatgcgttgggggaaaacatcctcgaccgcgttgaaaccatccgcaag
ctgtctaaatcttcccgtgccggtaacgaagcgagtcgtcaggagctgctcaccaccttg
cagaacctctctaacgatgagctgctgcctgttgcacgcgcattcagccagttcctgaac
ctggcaaacacggctgagcaataccacagcatttcgccaaacggcgaagctgccagcaac
ccggaagtcattgcccgtacgcttcgtaaactcaaagaccagccaaacctcaacgaagcc
accatcaaaaaagcggtggaatccctttcgctggagctggtgctgaccgcccacccaacc
gaaatcacccgtcgcaccctgatccacaaaatggtcgaagtgaacaactgcctgaagcag
ttggataacaaagacattgccgactacgaacgtaaccagctgatgcgccgtctgcgccag
ctgattgctcagtcctggcacaccgatgaaattcgtaagcatcgcccaagcccggtagac
gaggccaaatggggctttgcagtggtggaaaacagcctgtgggaaggcgttccgaactac
ctgcgtgagctgaacgaacagctggaagcgaacctgggctaccgcctgccggtggatttt
gtcccggtacgctttacctcctggatgggcggcgaccgtgacggtaacccgaacgtgacg
gcggaaatcacccgccacgtgctgctgctgagtcgctggaaagccaccgatctgttcctg
aaagacattcatgtgctgatctccgagctgtcgatggtggaagcgacgccagaactgcgc
gcgctggccggtgaagaaggtgccagcgagccgtatcgtttcctgatgaaaaaactgcgt
agccagctgatggcgacccaggcctggctggaagcacgcctgaaaggccagcgcctgccg
aagccagaaggtctcctgagccagaacgaacagctctgggagccgctatacgcctgctat
aaatcactgcaggcctgtggcatgggcatcatcgccaatggcgaactgctcgacaccctg
cgccgcgtgaagtgttttggcgtgccgctggtgcgtatcgacgtgcgtcaggagagcacc
cgccataccgaagcgctgggcgaactgacccgctatctcggcatcggcgactatgaaagc
tggtctgaagccgacaaacaggccttcctgatccgcgagctgaactctaagcgtcctctg
ctgccacgcaactgggagccaagcaacgaaacccgcgaagtgctcaacacctgtaaagcg
atcgttgatgcgccgaaaggatcggtggccgcctatgtgatctccatggcgaaaaccccg
tccgacgtgctgggcgttcaccttctgctgaaagaagccggtatcgactacgctctgcct
gtagcgccactatttgagaccctcgacgacctgaacaacgccaacgacgtgatgacccag
ttactcaatatcgactggtatcgcggctttattcagggcaaacagatggtgatgatcggc
tattccgactcagcaaaagatgcaggcgtgatggccgcctcctgggcgcagtatcaggcg
caggacgccctgatcaaaacctgcgagaaagccggtattgagctgacccttttccacggt
cgcggtggctccattggtcgcggcggtgcgccagcgcacgcggcactactgtcacagccg
ccgggaagcctgaagggcgggctgcgcgtcaccgaacagggtgagatgatccgcttcaaa
tacggtctgccggaagtgaccatcagcagcctgtcgctttataccagtgcgattctggaa
gcgaacctgctgccaccgccagagccgaaagcgtcctggtgccatatcatggacgagctg
tcggatatctcctgcgatctgtaccgcggctacgtgcgtgaaaacaaagatttcgtgcct
tacttccgctctgcaacgccagagcaggagctgggtaaactgccgctgggttcacgtccg
gctaagcgtcgcccaaccggcggtgtggagtctctgcgtgcgatcccgtggatcttcgcc
tggacgcaaaaccgtctgatgctgccagcctggctgggtgccggtgcggcgctccagaag
gtggtggaagacggtaaacagagtgagctggaaaccatgtgccgcgactggccgttcttc
tctacccgtctgggtatgctggagatggtcttctcgaaagctgacctgtggctggcggaa
tattacgatcagcgtctggtgaagcctgagctgtgggcactgggtaaagagctgcgcgag
ctgctacaaggcgacatcaaggtggtgctggatatcgctaacgattcccacctgatggaa
gacctgccgtggattgccgagtctatccagctgcgtaacatctataccgacccgctgaac
gttctgcaggcagagctgctgcaccgttcgcgtctggcggaagaagaagggaaagagccg
gatccacgcgttgaacaagcgctgatggtgacgattgcgggcgttgcagcgggtatgcgt
aacaccggttaa

DBGET integrated database retrieval system