KEGG   Endosymbiont of unidentified scaly snail isolate Monju: EBS_0434Help
Entry
EBS_0434          CDS       T04530                                 

Gene name
ddl
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
enm  Endosymbiont of unidentified scaly snail isolate Monju
Pathway
enm00473  D-Alanine metabolism
enm00550  Peptidoglycan biosynthesis
enm01100  Metabolic pathways
enm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:enm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    EBS_0434 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EBS_0434 (ddl)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    EBS_0434 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:enm01011]
    EBS_0434 (ddl)
Enzymes [BR:enm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     EBS_0434 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:enm01011]
 Precursor biosynthesis
  Amino acid ligase
   EBS_0434 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 CPSase_L_D2 RimK ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: BAN68405
UniProt: S6CEW1
LinkDB All DBs
Position
477985..478917
Genome map
AA seq 310 aa AA seqDB search
MSLCAEDFGKVAVLMGGWSAEREVSLVSGAAVLEGLRARGVDAHGIDMGRDVLEVLRAGG
FDRVFNVVHGRGGEDGELQGLLEVAGIPCTGTGVLGSALAMDKYRSKLVWAGMGLPTPGF
VLVEDEADLEHAARLGFPLMVKAALEGSSIGVYRVEDAVALREAWEKAAACDSHVMAEVC
IEGEEFTCAILDGEALPMIRLETPHSFYDYEAKYRADDTRYLIPCGLSAEEEAAAQALCQ
RAFAAVGAAGWGRVDLMRDAGGRLWLIEVNTVPGMTDHSLVPMAARAAGIDFPELVWRIL
AQTLEVEHGG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgtgcgcggaagatttcggcaaggtggcggtgctgatgggtggctggagcgcc
gagcgcgaggtctcgctggtcagcggcgcggcagtgctcgaagggctgcgtgcgcgcggc
gtggatgcgcacggcatcgacatggggcgcgacgtgctcgaggtgctgcgcgccggcggt
ttcgatcgcgtgttcaatgtcgtccacggacgaggcggtgaggacggtgaacttcagggg
ctgctggaggttgcgggcattccctgtaccggcacgggcgtgctgggctcggcgctggcg
atggacaagtaccgctccaagctggtctgggccggcatggggctgccgacgcccggcttc
gtgctcgtcgaggacgaggccgacctggagcatgccgcgcgcctgggctttccgctgatg
gtcaaggccgcgctggaagggtcgagcatcggcgtctatcgcgtggaggatgccgtggca
ctgcgtgaggcctgggagaaggcggcggcctgcgacagccacgtgatggccgaggtctgt
atcgaaggggaggaattcacctgcgccatcctcgatggtgaggcgctgccgatgatccgc
ctggagaccccgcacagtttctacgactacgaggccaagtaccgcgccgacgacacccgt
tacctgatcccctgcggcctgtcggccgaagaggaggctgccgcccaggccctgtgccag
cgcgccttcgcagcggtgggggcggcgggctggggtcgagtggacctgatgcgcgatgcc
ggcgggcggctctggctgatcgaggtgaacacggtaccgggcatgaccgatcacagtctg
gtgcccatggccgcgcgcgcggccggtatcgattttcccgaactggtctggcgcatcctc
gcgcagaccctggaggtggaacatggcggctag

DBGET integrated database retrieval system