KEGG   Endosymbiont of unidentified scaly snail isolate Monju: EBS_0695Help
Entry
EBS_0695          CDS       T04530                                 

Gene name
rbcS
Definition
(GenBank) ribulose-bisphosphate carboxylase small chain
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
enm  Endosymbiont of unidentified scaly snail isolate Monju
Pathway
enm00630  Glyoxylate and dicarboxylate metabolism
enm01100  Metabolic pathways
enm01120  Microbial metabolism in diverse environments
enm01200  Carbon metabolism
Module
enm_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:enm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    EBS_0695 (rbcS)
Enzymes [BR:enm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     EBS_0695 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small REF
Motif
Other DBs
NCBI-ProteinID: BAN68644
UniProt: S6BRK2
LinkDB All DBs
Position
complement(758014..758379)
Genome map
AA seq 121 aa AA seqDB search
MSEIQDYNSSVSDPSSRKFETFSYLPELGVEKIRKQVEYIVSKGWNPAIEHTEPENAFDH
YWYMWKLPMFGETDVDAILAEAEACHKAHPSHHVRLIGYDNYAQSQGTAMVIFRGPISAK
C
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaatccaagactacaactcgagcgtcagcgatccgtcgagccgcaagttcgag
accttctcctacctgcccgaactcggcgtggaaaagatccgcaagcaggtcgagtacatc
gtcagcaagggctggaacccggccatcgagcacaccgagccggagaacgccttcgaccac
tactggtacatgtggaagctgccgatgttcggcgaaaccgacgtggacgccatcctggcc
gaggccgaggcatgccacaaggcgcatccctcgcatcacgtgcgcctgatcggctacgac
aactatgcccagtcgcaaggcactgcgatggtgatcttccgcggccccatcagcgccaag
tgctga

DBGET integrated database retrieval system