KEGG   Endosymbiont of unidentified scaly snail isolate Monju: EBS_1800Help
Entry
EBS_1800          CDS       T04530                                 

Gene name
thiO
Definition
(GenBank) glycine oxidase
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
enm  Endosymbiont of unidentified scaly snail isolate Monju
Pathway
enm00730  Thiamine metabolism
enm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:enm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    EBS_1800 (thiO)
Enzymes [BR:enm01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     EBS_1800 (thiO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 HI0933_like Pyr_redox_2 Pyr_redox Amino_oxidase NAD_binding_8 NAD_binding_7 FAD_binding_3 Pyr_redox_3 ApbA Trp_halogenase Thi4 adh_short AlaDh_PNT_C Shikimate_DH TruB_C 3HCDH_N Lycopene_cycl UDPG_MGDP_dh_N FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: BAN69671
UniProt: S6BKI4
LinkDB All DBs
Position
1947771..1948871
Genome map
AA seq 366 aa AA seqDB search
MKSDRHILVIGGGAIGLLTARELASAGAQVTVLERGQPGRESSWAGGGIVSPLFPWRYLD
SITALASWSQTRYPEACAQLARDTGIDPEFTVNGMLMVAEDEIDTALAWAARHGRRLETV
DAATFRALEPAAARPPETGLWMPEVGQLRNPRLLAALLADLQARGVTLRSDTPVNGLWIR
NGVCRGVTTPRGHVEADRVIVCAGAWSGELLGDLPAPPAVRPVRGQMLLFQTTPDTISRI
VLEDQRYIIPRRDGHVLFGSSMEEVGFDKSTTEAMREELLALVRERFPVMRDAPLVKHWA
GLRPGSPAGVPYISAHPEIGGLYVNAGQFRNGIVIGLASARLAADLVLERPPILDPAPYG
WNAPRG
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatcggatcgacacatcctggtcatcggtggcggggccatcggcctgcttaccgcg
cgtgaactggcgagtgccggcgcgcaagtcactgtgctcgaacgcggccaacccggtcgc
gagtcgagctgggccggcggtggcatcgtctcgccgctgtttccctggcgctatctcgac
agcatcaccgcactagcgagctggagccagacgcgatatcccgaggcctgcgcgcaactg
gcacgcgataccggcatcgaccccgagttcaccgtcaacggcatgctgatggtggccgaa
gacgagatcgacacggccctggcctgggccgcccgacatggccgccgactggagacggtc
gatgccgccacctttcgtgcactggagcccgctgcagcccgcccgccagagaccgggctg
tggatgcccgaggtgggccagctgcgaaatccccgactgctggccgccctgctcgctgat
ttacaggcccggggcgttacgctgcgctctgacacgccggtgaacggactgtggatacgc
aacggcgtctgccggggcgtgaccacgcccaggggccatgtcgaggccgaccgggtgatc
gtctgcgccggcgcctggagtggcgagctgctgggcgatcttcccgctccgccggcggtg
cgtccggtacgcggccagatgctgctgttccagaccacgccagacaccatctcgcgcatc
gtgctcgaagaccagcgctacatcatcccacgccgcgacggccacgtgctgttcggctcc
agcatggaagaagtcggcttcgacaaatccaccaccgaggccatgcgcgaggaactgctg
gcgctggtgcgcgaacgtttcccggtgatgcgcgacgccccgctggtaaaacactgggcc
ggcctgcgtcccggctcaccggcaggtgtgccctacatctcggcgcatcccgagatcggg
gggctgtacgtcaacgcgggacagttccgcaacgggatcgtcatcggtctggcttcggcg
cgactggctgccgacctggtgctggaacgcccgcccattctcgatccggcaccctacggc
tggaacgcaccccggggctag

DBGET integrated database retrieval system