KEGG   Endosymbiont of unidentified scaly snail isolate Monju: EBS_2354Help
Entry
EBS_2354          CDS       T04530                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
enm  Endosymbiont of unidentified scaly snail isolate Monju
Pathway
enm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
enm01100  Metabolic pathways
enm01110  Biosynthesis of secondary metabolites
enm01130  Biosynthesis of antibiotics
enm01230  Biosynthesis of amino acids
Module
enm_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:enm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EBS_2354 (aroK)
Enzymes [BR:enm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     EBS_2354 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin dNK AAA Cytidylate_kin2 AAA_24 TsaE AAA_17 CoaE RuvB_N PduV-EutP AAA_22 AAA_16 AAA_28 AAA_5 ABC_tran Zeta_toxin Rad17 RNA_helicase
Motif
Other DBs
NCBI-ProteinID: BAN70195
UniProt: S6CH10
LinkDB All DBs
Position
complement(2542399..2542911)
Genome map
AA seq 170 aa AA seqDB search
MAKPNRIFLIGPMGAGKTTVGKTLASQLGLNFVDTDQEIQRRTGVDIPTIFEYEGEEGFR
DREQRVIDDLTRIDQQVLATGGGAVLRPANRDRLSARGIVVYLACSPEQQYDRTYRDRKR
PLIQTEDPLGRLRELMAEREPLYRETADYTVSTEGRSAGAVAREIIDLVT
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaccgaaccgtatctttctcatcggccccatgggggcgggcaagaccaccgtt
ggcaagaccctggcctcgcagctcggtctgaacttcgtggacaccgatcaggagatccag
cgccgtaccggcgtggatatcccgaccatcttcgaatacgagggcgaggaaggttttcgc
gaccgcgaacaacgggtgatcgatgatctcacccgtatcgaccagcaggtgctggccacg
ggtggcggcgcagtgctgcggcccgccaaccgcgaccgcctgtcggcgcggggcatcgtg
gtctatctggcctgctcgcccgaacagcagtacgaccgtacctatcgtgatcgcaagcgc
cccctgatccagaccgaggatccgctgggtcgcttgcgcgaactgatggccgaacgcgaa
cccctgtaccgggagaccgccgactatacggtgtccaccgagggccgttcggcgggggcg
gtcgcccgtgagatcatcgatctggtgacctga

DBGET integrated database retrieval system