KEGG   Euhalothece natronophila: FRE64_02670
Entry
FRE64_02670       CDS       T06117                                 

Definition
(GenBank) 2-oxo acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
enn  Euhalothece natronophila
Pathway
enn00010  Glycolysis / Gluconeogenesis
enn00020  Citrate cycle (TCA cycle)
enn00620  Pyruvate metabolism
enn01100  Metabolic pathways
enn01110  Biosynthesis of secondary metabolites
enn01120  Microbial metabolism in diverse environments
enn01200  Carbon metabolism
Module
enn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:enn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FRE64_02670
   00020 Citrate cycle (TCA cycle)
    FRE64_02670
   00620 Pyruvate metabolism
    FRE64_02670
Enzymes [BR:enn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     FRE64_02670
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Ribosomal_L18p AATase Trypan_PARP PLRV_ORF5
Other DBs
NCBI-ProteinID: QDZ38939
UniProt: A0A5B8NLC4
LinkDB
Position
590585..591862
AA seq 425 aa
MIHDIFMPALSSTMTEGKIVSWAKSPGEKVQKGETILVVESDKADMDVESFHDGYLATIM
VEAGEQAPVGSAIGLLAETEAEIETAKEQAKNQTPEKSSDSTPKTPLEEAPAAKPQEPAP
QPAAATSTKKQDGRVVASPRARKLAKEYGVDLSTLQGSGPHGRIVASDIEAAAGKSPTPT
PQPTPTPQPTPQPSPTPAPSVSGEVVPFTTLQNSVVQNMVATVQVPTFHVGYTITTDELD
KLYKQIKSKGVTMTALLAKAVAMTLQKHPIVNASYTEKGTQYHGAINIAVAVAMEDGGLI
TPVLRNAAEQDIYTLSRNWKDLVKRARSKQLQPEEYSTGTFTLSNLGMFGVDRFDAILPP
GQGGILAIGASQPQVVATDDGMFGVRRQMSVNITCDHRIIYGAHAAAFLQDLAQLMENNP
QSLTM
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgatccacgacattttcatgcctgcactgagttcaactatgaccgaaggaaaaatcgtt
tcttgggcaaaatcccctggagagaaggtgcagaagggagaaactatcctcgtagtggaa
tcagacaaagcagatatggatgtggagtcgttccatgatggctatcttgccacgattatg
gtagaagcaggagaacaagcgcctgtgggatcagccattggcttacttgcagaaaccgaa
gcagaaattgaaacagccaaagagcaagctaaaaatcaaacaccagagaaaagtagcgat
agtaccccgaaaacgccgctagaggaagcgcctgctgcaaaaccccaagaaccagcgccc
caaccagcagccgctacttccactaaaaagcaggatggtcgtgtagtcgcctctcctcgc
gctcgcaagttagctaaggaatatggcgttgacctttctactttacaaggaagtggcccc
catgggcgcattgtcgccagtgatattgaagcagcggcaggtaagtctcctaccccgact
cctcaacctaccccgactcctcagccgacaccgcaaccctctcccacgccagcaccctct
gttagtggtgaggttgttcctttcacaactttacaaaattctgtggtgcaaaatatggtg
gcgacggtacaagttcccactttccatgtgggctataccatcaccacagatgaactagac
aaactctataaacagattaagtcgaaaggggtaacgatgacggcgttattagccaaagct
gtggcgatgacgttgcaaaaacatcccattgttaatgctagttataccgaaaaaggcact
caatatcatggggcgattaatattgcggttgctgtggcgatggaggatggaggcttaatt
actcctgttttacgtaatgccgctgaacaagatatttataccctctctcgcaattggaaa
gatttagtaaaacgcgctcgtagcaaacagttacaaccagaggaatatagcactggaaca
tttaccctgtctaatttgggaatgtttggggttgaccgttttgatgcaattttacctccc
ggacaaggaggcattcttgccattggtgcttctcaaccgcaggtagtggctactgatgat
ggcatgtttggggtgcgtcgtcagatgagtgtgaatattacttgcgatcatcgcattata
tatggcgctcatgccgccgctttcttacaagatttagcacaattaatggaaaataatccg
caatctttaacaatgtaa

DBGET integrated database retrieval system