KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_06730Help
Entry
ECENHK_06730      CDS       T02315                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
eno00010  Glycolysis / Gluconeogenesis
eno00260  Glycine, serine and threonine metabolism
eno00680  Methane metabolism
eno01100  Metabolic pathways
eno01110  Biosynthesis of secondary metabolites
eno01120  Microbial metabolism in diverse environments
eno01130  Biosynthesis of antibiotics
eno01200  Carbon metabolism
eno01230  Biosynthesis of amino acids
Module
eno_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eno_M00002  Glycolysis, core module involving three-carbon compounds
eno_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECENHK_06730 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    ECENHK_06730 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECENHK_06730 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:eno04131]
    ECENHK_06730 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eno04147]
    ECENHK_06730 (gpmA)
Enzymes [BR:eno01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ECENHK_06730 (gpmA)
Membrane trafficking [BR:eno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    ECENHK_06730 (gpmA)
Exosome [BR:eno04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ECENHK_06730 (gpmA)
  Exosomal proteins of melanoma cells
   ECENHK_06730 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AFP69229
LinkDB All DBs
Position
complement(1458877..1459629)
Genome map
AA seq 250 aa AA seqDB search
MAITKLVLVRHGESQWNNENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLTDAELPTTESLALTIDRVVPYWNETILPRLKSGERVI
IAAHGNSLRALVKYLDNMGEDEILELNIPTGVPLVYEFDENFKPIKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctattactaagctggtcctggtgcgtcacggcgaaagccagtggaacaacgaaaac
cgctttaccggttggtacgacgttgatctgtctgagaaaggcgtaagcgaagcaaaagca
gcaggtaaactgctgaaggaagaaggcttcagctttgattttgcttacacctctgtgctg
aaacgtgccatccacacgctgtggaacgtactcgacgaactggatcaggcctggctgccg
gttgagaaatcctggaaactgaacgagcgccactacggtgcgctgcagggtctcaacaaa
gccgaaaccgctgagaaatacggtgacgagcaggttaaacagtggcgtcgcggcttcgcg
gtaaccccaccagagctgaccaaagatgacgagcgctacccgggccacgacccgcgttac
gcgaaactgactgacgctgagctgccaaccaccgaaagcctggcgctgaccatcgaccgc
gttgtgccttactggaacgaaaccattctgccacgcctgaaaagcggtgagcgcgtgatc
atcgccgctcacggtaactccctgcgtgcgctggtgaaatacctggacaacatgggtgaa
gacgaaattcttgaactgaacatcccaactggcgtaccgctggtgtatgagttcgacgaa
aacttcaaaccaatcaaacactactatctgggtaacgcggatgaaatcgcagcgaaagcc
gcggctgtcgcgaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system