KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_13490Help
Entry
ECENHK_13490      CDS       T02315                                 

Definition
(GenBank) peptidoglycan synthase ftsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
eno00550  Peptidoglycan biosynthesis
eno01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:eno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ECENHK_13490
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ECENHK_13490
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eno01011]
    ECENHK_13490
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:eno03036]
    ECENHK_13490
Enzymes [BR:eno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ECENHK_13490
Peptidoglycan biosynthesis and degradation proteins [BR:eno01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   ECENHK_13490
Chromosome and associated proteins [BR:eno03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    ECENHK_13490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AFP70547
LinkDB All DBs
Position
complement(2860335..2862035)
Genome map
AA seq 566 aa AA seqDB search
MSAGNFTPARFALLCFAIFCSLAFLLGRVAWLQIIKPDNLVKQEDMRSLRQLTIDAPRGM
ITDREGRPLAVSVPVRAVWADPKTVLAKGGVGFDDRWQALASALHLSLNTLSSRINANPR
GRFIYLARQVDPAQAKWIDKLNLPGINLRDESRRFYPAGHVAANLIGFTNIDGQGIEGVE
KSFNTQLTGKAGVRQVREDRYGRVVENLTEVAPTPAHNIQLSIDERLQTITEDALDNAVA
WNKAESGASVLINIPTGEILAMASYPDFNPNNREGATINDFRNRAISDTFEPGSTVKPLV
LMTALQQGLVQPDSVIDTHPYTLDGHRIRDVGYYPELTMTGILQKSSDTGVSRLSLAMPI
QHLLDTYRNFGFGTNTGLGLTGESAGLLPQRKYWSQLDRATFAFGYGLMVTPLQLAHVYA
TIGGFGLERPLSITRIDPPVIGHRVMPEEIAHEVEHMMESVALPGGGGVKAAVRDYRVAV
KTGTAKKIDDSGKYVDKYVAYTAGVAPASDPRFALVVVINDPQNGAYYGGAVSAPVFSEI
MGNVLRLENIKPDGLPAGSDHLIVMR
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctggcaattttacaccagcgcgttttgcgctgctctgttttgctattttctgc
agtctggcttttttactgggtcgtgttgcctggctacaaatcatcaaaccagacaacctg
gtgaagcaggaagatatgcgatcgctgcgtcagctgacgattgatgctccacgagggatg
atcacggatcgtgaaggccgacctctggcggtcagcgtgcccgtcagagccgtatgggcc
gaccctaaaacggtactcgcaaaagggggcgttggttttgacgatcgctggcaggcgctg
gcgagcgcgcttcatctctccctgaataccctctcttcgcgcattaacgccaatcccagg
ggcaggttcatttacctggctcgtcaggttgatcctgcgcaggccaaatggattgataaa
ctgaatttgccgggaattaacctgcgtgatgaatcgcgccgtttttacccggcaggccac
gtggcggccaatctgattggcttcaccaatattgacgggcagggcattgaaggggtggaa
aaaagctttaatactcagctgacgggtaaagcgggtgtccgacaggtaagggaggatcgc
tacggccgggtggttgaaaacctgacggaagttgcgcccacgccagcgcataacattcag
ctcagcatcgacgagcggctacagaccattaccgaagacgcgctggataatgccgtggcc
tggaataaggccgagtcaggggcatcggtattgatcaatatcccaaccggcgaaatactc
gccatggcgagttacccggacttcaaccccaataaccgggaaggcgcgacaattaacgat
tttcgtaaccgggctattagcgatacgttcgaacccggttcgaccgttaaaccgctggtg
ctgatgacggcgctgcagcaggggctggtccagccggacagcgtgattgacacccatcct
tatacacttgatggacaccgtattcgcgacgtgggctactacccggagctgacgatgacc
gggatcctgcagaaatcgagcgataccggagtctcccggctctcgctggcgatgcccata
cagcaccttcttgatacctaccggaactttggttttggcacgaacacgggtcttggctta
acgggggagagcgcgggcctgttgccacagcgtaagtactggagccagctcgaccgcgcg
acctttgccttcggctatggcctgatggtgacgccgctccagcttgcccacgtctatgcg
acgattggcggatttggactggagcgtcccctgtcgatcacccgcatcgatccccccgtt
atcgggcaccgcgttatgccggaggagatcgcgcatgaggtggagcatatgatggagagc
gttgcgctacccggtggcggtggcgttaaggccgctgtgcgtgattaccgcgtggcggta
aaaaccggtacggcgaagaagattgatgacagcggcaaatatgtcgataaatatgtcgcc
tataccgcgggcgtcgcgcctgcgagcgatccgcgctttgcgctggtcgtggtgattaac
gatcctcaaaacggggcgtactacggtggggcggtttcagcgccggttttcagcgaaatc
atgggcaacgtgctgcgcctggagaatataaaacctgatggcctcccggccggttctgac
caccttatcgtcatgcggtaa

DBGET integrated database retrieval system