KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_14470Help
Entry
ECENHK_14470      CDS       T02315                                 

Gene name
dacD
Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
eno00550  Peptidoglycan biosynthesis
eno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ECENHK_14470 (dacD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:eno01002]
    ECENHK_14470 (dacD)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eno01011]
    ECENHK_14470 (dacD)
Enzymes [BR:eno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ECENHK_14470 (dacD)
Peptidases and inhibitors [BR:eno01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   ECENHK_14470 (dacD)
Peptidoglycan biosynthesis and degradation proteins [BR:eno01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   ECENHK_14470 (dacD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 CDPS
Motif
Other DBs
NCBI-ProteinID: AFP70741
UniProt: A0A156Q0T3
LinkDB All DBs
Position
complement(3065673..3066839)
Genome map
AA seq 388 aa AA seqDB search
MKRRLFIAVSLLASSISSAFAAEPLDFSPQPPAIQAGSWVLMDYTTGQILTAGNEHQQRN
PASLTKLMTGYVVDRAIDSHRITPDDIVTVGRDAWAKGNPVFDGSSLMFLKEGDRVSVRD
LSRGLIVDSGNDACVALADHVAGGQPQFVKMMNDYVQKLNLRDTHFETVHGLDAPGQHSS
AYDLAVLSRAIIHGEPEFYHMYSEKSLTWNGITQQNRNGLLWDKTMNVDGLKTGHTSGAG
FNLIASAVDGQRRLIAVVMGADSPKGREDQARKLLHWGQQNFDTVQILHSGKKVGTERIW
YGDKEQVNLGTDQDFWLALPKAEVANIKAKYVLDKKELEAPIAAHQRVGEIQLYDRDKVV
AHWPLVTLERVDKGGIFSRLSDYLHQKI
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacgccgtctgtttattgctgtttctttactcgcttcgagtatctcatctgctttt
gcggccgaaccgctggatttttccccgcagcctccggccattcaggcgggctcgtgggtg
ctgatggattacacgactggtcagatcttaacggcgggcaacgaacatcaacaacgtaat
ccggcgagccttactaagctgatgacgggttatgtggttgatcgggccattgatagccat
cgcattacgccggatgacattgtcaccgtaggccgtgacgcatgggccaaagggaacccg
gtttttgacggatcatccctgatgttcctgaaagagggcgatcgcgtctccgtgcgggac
ttaagccgcgggctgattgtggattccggcaacgacgcctgcgtggcgctggccgatcac
gtagcgggtgggcagccgcagtttgtgaagatgatgaacgactatgtgcagaagctgaac
ctgcgcgatacgcactttgaaaccgtccatgggcttgatgcgccgggtcaacacagctcg
gcctatgacctggccgttctctcccgggctatcattcacggtgagcctgagttttaccat
atgtacagcgaaaagagcctcacctggaacgggatcacccagcaaaaccgtaacggcctg
ctgtgggataaaaccatgaacgtggatggcctcaaaacggggcacacttctggcgcgggc
tttaacctgattgcttccgccgttgacggtcagcgccgtttaatcgcggtggtgatgggg
gcggacagcccgaaagggcgcgaagaccaggcccggaaactgctgcactggggtcagcag
aatttcgatacggtgcagattctgcacagcggtaaaaaagtagggacagaacgtatctgg
tacggtgataaagaacaggtaaatctgggtacggatcaggacttctggcttgctttaccg
aaagcggaagtggcgaacattaaggcgaaatacgttctggataaaaaagagctggaagcg
ccgattgccgcacatcagcgggttggggagatccagctctatgaccgcgacaaagtggtg
gcacactggccgctggtcaccctggaacgtgttgataaaggtgggattttctctcgcctc
agtgattacctgcatcaaaaaatctaa

DBGET integrated database retrieval system