KEGG   Enterobacter kobei ENHKU01: ECENHK_19445
Entry
ECENHK_19445      CDS       T02315                                 

Definition
(GenBank) galactitol-1-phosphate dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
eno  Enterobacter kobei ENHKU01
Pathway
eno00052  Galactose metabolism
eno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    ECENHK_19445
Enzymes [BR:eno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     ECENHK_19445
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 2-Hacid_dh_C TrkA_N Methyltransf_31 UDPG_MGDP_dh_N MTS Methyltransf_25 PrmA ELFV_dehydrog Shikimate_DH 3HCDH_N ThiF
Other DBs
NCBI-ProteinID: AFP71720
LinkDB
Position
4151918..4152961
AA seq 347 aa
MKSVVIHAEGSVRVEERPIPQIQDADEVLVRIVCSGLCGSDIPRIFAKGAHYYPIILGHE
FSGHVEACGADVKDLQAGDAVACIPLLPCFSCPECGQGYYSLCKQYQFVGSRSDGGNAEY
IVVKRANLFRLPAEMAIEDGAFIEPVTVGLHAFHLASGCKGKNVIIVGAGTIGLLAMQCA
LALGAKSVTAIDINDDKLALAKTLGATQVFNSRTLSTDDILNAQNDSRFDQLVLETAGTP
QTVSLAIDIAGPHAQVALVGTLHHDLNLSAATFGKILRKELTLLGSWMNYSAPWPGEEWE
TAVRLLTGKKLQLEPLIAHTGDSESFAQAVQALNGAPMQGKIMLRFA
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggtaattcacgctgagggcagcgtgcgcgttgaagaacgtccgatccct
caaatacaggatgcggatgaagttctggtgcgcattgtttgctcagggttatgcggctca
gatatcccgcgtatttttgccaaaggggcacactattatcctatcatccttggccatgaa
tttagcggacacgtcgaagcctgtggtgcagatgtaaaggacctccaggcgggagatgct
gtggcctgcattccacttctgccctgtttttcctgcccagagtgtgggcaaggctactac
tcgctgtgtaagcagtaccagtttgtcggctcacgcagtgacggtggcaatgccgaatat
attgtcgtgaagcgcgcgaacttgttccgcctgccagcagagatggcaatcgaagacggg
gcatttatcgaacctgtcaccgtaggtttgcacgcgtttcatctggcttcaggctgcaaa
ggtaaaaatgtcattatcgtcggagcggggacgatcggtctgctggcgatgcagtgcgcg
ttggcgctcggggcaaagagcgtaactgcgattgatatcaacgacgataaactcgccctg
gcgaaaacactgggtgcgactcaagtattcaacagccgtaccttgagcaccgatgacatt
ctcaacgcgcagaatgacagtcgatttgatcaactggtgctggagaccgcaggaacacca
caaactgtctcgcttgccattgatattgctggccctcacgcacaagttgcgctggtcggt
acattgcatcatgacctgaatttatctgccgcaacctttggcaaaatattacgtaaggaa
ctgacgcttttgggtagctggatgaactactctgcaccgtggccaggggaagagtgggaa
acagcagtccgcctgctcaccgggaaaaaactgcaactggagccgctcattgctcatact
ggcgacagtgaaagcttcgctcaggccgtgcaggcactgaatggggcaccgatgcagggc
aaaattatgctgcgtttcgcctaa

DBGET integrated database retrieval system