KEGG   Enterobacter sp. R4-368: H650_06315Help
Entry
H650_06315        CDS       T02700                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
enr  Enterobacter sp. R4-368
Pathway
enr00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:enr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    H650_06315
Enzymes [BR:enr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     H650_06315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Cellulase DUF4434
Motif
Other DBs
NCBI-ProteinID: AGN84832
UniProt: R9VJ08
LinkDB All DBs
Position
complement(1190258..1192315)
Genome map
AA seq 685 aa AA seqDB search
MNKFAPLSPKVVSLLHGADYNPEQWENYPDIIDNDIAMMQQAKCNVMSVGIFSWSKLEPQ
EGVFNFAWLDEVIDKLYAAGIHIFLATPSGARPAWLSQKYPEVLRVGRDRVPALHGGRHN
HCMTSPVYREKTLKINTLLAERYAHHPAVLGWHISNEYGGECHCALCQEKFRGWLKARYQ
TLDNLNHAWWSDFWSHTYSDWSQIQSPAPQGEVSIHGLNLDWRRFNTAQVTDFCRHEVAP
LKTANAALPVTTNFMEYFYDYDYWQLAEAIDFISWDSYPMWHRDKDETALACYTAMYHDM
MRTLKGGKPFVLMESTPSVTNWQPTSKLKKPGMHILSSLQAVAHGADSVQYFQWRKSRGS
VEKFHGAVIDHVGHLDTRVGREVCALGDMLSKLTPVMGCRTDARVAIIFDQQNRWALDDA
EGPRNKGLEYEKTVNEHYRPFWEKGIAVDVINADADLSRYQLVIAPMLYMVRDGFAERAE
AFVAAGGHLVTSYWTGVVNESDLCYLGGFPGPLRKLLGIWAEEIDCLDDNERNLVQGLAG
NEAGLQGPYQARHLCELIHTESAQALATYRDDFYAGRPAVTVNHVGKGKAWHVASRNDLA
FQRDFFANIIEELKLPRALQHDLPPGVVATARTDGESTFVFIQNFSAQQQVITLPDGYQD
CLSGSSVSGAMSLAPWDCRVIRRNA
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatttgcgcctttaagcccgaaggttgtctcgctattgcatggcgcggactat
aacccggaacagtgggaaaactatcccgatattattgataacgacattgccatgatgcag
caggcaaaatgcaatgtgatgtccgtcggcatattcagctggtcgaaactcgaaccgcag
gaaggggtatttaatttcgcctggctggatgaggtcatcgataaattatatgccgccggt
atccatatatttctggccacgccaagcggcgcgcgtccggcgtggttgtcacaaaaatac
ccggaggtgctgcgggtcgggcgcgatcgcgttccggcgctgcacggcgggcggcacaac
cactgcatgacctcgccggtgtaccgggaaaaaacgctgaaaatcaatacgctgctggca
gagcgctatgcgcatcatccggcggtgctgggctggcacatttccaatgaatacggcggt
gaatgccactgcgcgctgtgtcaggagaaattccgcggctggctgaaagcacgttatcag
acgctggacaacctcaatcacgcctggtggagcgacttctggagccacacttacagcgac
tggtcgcagatccagtcaccggcgccgcagggggaagtctccattcacgggctgaacctc
gactggcggcgttttaacaccgcgcaggtaaccgatttttgccgtcatgaagtggccccg
ctgaaaaccgccaacgcggcactgccggtgaccaccaattttatggagtatttctacgat
tacgactactggcaactggctgaagcgatcgattttatctcctgggacagctacccgatg
tggcaccgggataaagacgaaacggcgctggcttgctacaccgccatgtatcacgacatg
atgcgcacgctgaaaggcggcaaaccgtttgtgctgatggagtcgacgccgagcgtcacc
aactggcagccgaccagcaagctgaaaaagccgggaatgcacattctctcgtcgctgcag
gcggtggcacacggtgccgattcagtgcagtacttccagtggcgtaaaagccgtggttcg
gtcgagaagttccacggcgcggttatcgatcacgtcgggcatctggatacgcgcgtgggg
cgtgaagtgtgcgcgctgggcgacatgctcagtaaactcaccccggtaatggggtgccga
accgatgcccgcgtggcaattatcttcgatcagcagaaccgctgggcgctggatgacgcc
gaagggccgcgcaataaaggcctggagtatgaaaaaacggttaacgagcactatcgcccg
ttctgggaaaaaggcattgccgtggatgtgatcaatgccgatgccgatctcagccgttac
cagctggtgattgcgccgatgctgtatatggtgcgcgacggttttgccgaacgcgcagaa
gcgtttgttgcggcgggcggtcatctggtgacctcctactggaccggcgtggtcaatgaa
agcgatctctgttatctcggcggtttccctggcccgctgcgcaaattgctgggtatctgg
gcagaagagattgattgcctggacgacaacgagcgcaatctggtgcaggggctggcgggt
aacgaggccggattacagggaccgtatcaggcgcgccatctgtgtgagttgatccatacc
gagagcgcgcaggcgctggcaacctaccgggatgatttctacgccgggcgacccgccgtg
acggtcaatcatgtcggcaaaggcaaggcctggcacgtcgcatcacgcaacgatctcgct
ttccagcgtgatttcttcgccaacattattgaggagttgaagttgccgcgcgcgttacaa
cacgatttgccgccgggcgtcgttgccacggcgcgtacggatggcgaaagcacgtttgtc
tttattcagaactttagcgcccagcagcaggtgataacgctgcctgacggttatcaggat
tgtttatccggttcgtcggtcagcggcgcgatgtcgctggctccctgggattgccgggtt
attcgccgtaacgcataa

DBGET integrated database retrieval system