KEGG   Enterobacter sp. R4-368: H650_09405Help
Entry
H650_09405        CDS       T02700                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
enr  Enterobacter sp. R4-368
Pathway
enr00250  Alanine, aspartate and glutamate metabolism
enr00410  beta-Alanine metabolism
enr00430  Taurine and hypotaurine metabolism
enr00650  Butanoate metabolism
enr01100  Metabolic pathways
enr01110  Biosynthesis of secondary metabolites
enr01120  Microbial metabolism in diverse environments
enr02024  Quorum sensing
Module
enr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:enr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    H650_09405
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    H650_09405
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    H650_09405
   00430 Taurine and hypotaurine metabolism
    H650_09405
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    H650_09405
Enzymes [BR:enr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     H650_09405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AGN85370
UniProt: R9VPN2
LinkDB All DBs
Position
complement(1826968..1828353)
Genome map
AA seq 461 aa AA seqDB search
MDEQYPGIDDIYASLELSSSLEKHQFPAKERDPRNVFAAVRDELMLDGNSRQNLATFCQT
WVDDEIRTLMDLSIDKNMIDKDEYPQTAEIESRCVHMLADLWHSPEAQNTLGCSTIGSSE
AAMLGGLALKWRWRKKQAAAGKPTDKPNLICGPVQICWHKFARYFDVELREIPLQGQRLV
MNAEEVIKRVDENTIGVVPTMGVTFSCQYEPVKAVHDALDKLQQETGLDIPIHVDGASGG
FLAPFCAPDIAWDFRLPRVKSINASGHKFGLAPLGAGWVVWREAADLPEELIFNVNYLGG
NMPTFALNFSRPGGQVIAQYYNFLRLGREGYTKIHHACYQTAQYLAREIDKLGPFKILFD
GDSQQGIPALAWTLRTERAIGGYTLYDLADRLRSRGWQVPAYSMPAHREDLVIQRVLVRH
GVSHDLASLLVDDIKRALDYFSRHPVINPLSAEEASGFNHA
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggatgagcaataccctggcatagatgatatttatgcctccctggaattatcttcgtcc
ctggaaaaacaccagttccccgctaaagaacgggacccgcgcaatgtctttgccgcagta
cgcgacgaattgatgcttgacggtaactcacgacaaaacctggcaacgttttgccagaca
tgggtcgatgatgaaattcggacattgatggatttgtccatcgacaagaacatgatcgat
aaagacgaatacccgcaaacggctgaaattgagtctcgctgcgtacatatgctggccgat
ttatggcactcgccggaggcgcaaaacacgctcggttgctcgacgattggttcctctgaa
gcggcaatgctcggcgggctggcgctgaaatggcgctggcgaaaaaaacaggccgctgca
ggcaaacctaccgacaaaccgaacctgatctgcgggcctgtgcaaatctgctggcacaaa
tttgcccgctattttgatgttgagctgcgcgaaattcccctgcaaggccagcggttagtg
atgaacgccgaagaggtgatcaagcgggttgatgagaacaccattggcgttgtcccgacg
atgggcgtcaccttctcgtgccagtatgagccggtaaaagcggtgcatgatgcgctggat
aagctgcaacaggaaaccggtcttgatattcccatccatgttgacggtgccagcggcggg
tttctggcgccgttttgcgcgccggatattgcgtgggattttcgcctgccgcgggtgaaa
tcaattaatgcctctggccacaaattcggtcttgcaccgctgggtgccggttgggtcgta
tggcgcgaggccgctgatttgccggaagaactgatttttaacgttaactacctcggcggc
aacatgccgacgttcgccctcaacttttcacgacctggcgggcaggtcattgcccagtat
tacaatttcctgcgtctgggacgggaaggctacacgaaaattcatcacgcctgttaccag
acagcgcagtatctggcgcgggaaatcgacaaacttgggccgttcaaaatcttgttcgat
ggcgacagccagcaaggtattcccgcgctggcgtggacgctgcgcaccgagcgcgccatt
ggcggatacaccctttatgaccttgcagatcgcctgcgcagccgcggctggcaggtgccc
gcctattcaatgccagcccatcgcgaagatttagttatccagagggtgctggtgcgccac
ggtgtaagccatgatctcgccagcttgttggtggacgatattaagcgcgcgcttgactac
ttttcccgccatccggtcataaacccgctcagcgctgaggaagccagtggttttaatcac
gcctga

DBGET integrated database retrieval system