KEGG   Enterobacter sp. R4-368: H650_14435Help
Entry
H650_14435        CDS       T02700                                 

Gene name
tdh
Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
enr  Enterobacter sp. R4-368
Pathway
enr00260  Glycine, serine and threonine metabolism
enr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:enr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    H650_14435 (tdh)
Enzymes [BR:enr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     H650_14435 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C FAD_binding_3 HI0933_like FAD_binding_2 FAD_oxidored Pyr_redox_3 Pyr_redox_2 Methyltransf_25 MTS Pyr_redox UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AGN86286
UniProt: R9VPT0
LinkDB All DBs
Position
complement(2862613..2863638)
Genome map
AA seq 341 aa AA seqDB search
MKALSKLKAEEGIWMTDVPEPDVGHNDLLIKIRKTAICGTDVHIYNWDDWSQKTIPVPMV
VGHEYVGEVVGIGQEVKGFKIGDRVSGEGHITCGHCRNCRAGRTHLCRNTTGVGVNRPGC
FAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDLVGEDVLVSGAGPIGIMAA
AVAKHVGARHVVITDVNEYRLDLARKMGVTRAVNVAKENLADVMAELGMTEGFDVGLEMS
GAPPAFRTMLDTMNHGGRIAMLGIPPSDMSIDWTKVIFKGLFIKGIYGREMFETWYKMAA
LIQSGLDLSPIITHRFSINEFQQGFDAMRSGQSGKVILSWD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgttatccaaactgaaagcagaagaaggcatctggatgaccgacgtaccggag
ccggatgttggtcataacgatctgctgattaaaattcgcaaaaccgcgatttgtggcact
gacgtgcacatctacaactgggacgactggtcgcaaaaaaccattcctgtaccgatggtc
gtcggccatgaatatgtcggcgaagtggtgggcatcggccaggaagtgaaaggttttaaa
attggcgatcgcgtttccggtgaaggccatattacctgtggtcattgccgtaactgccgc
gccgggcgtacgcatctgtgccgtaacaccacgggtgtgggcgtcaaccgtccgggctgt
tttgccgaatacctggtgatcccggcgttcaacgctttcaaaatccccgacaatatatct
gacgatttggcgtcgattttcgatccgtttggtaacgcggtgcacacggcgctctccttt
gatttggtgggagaagatgtgctggtctccggcgcaggcccgattggtattatggccgca
gcggtggcaaaacacgttggtgcacgccatgtggttatcaccgatgtgaatgagtaccgc
ctcgatctggcgcgcaaaatgggtgttacccgcgcggttaacgtcgccaaagagaatctg
gcggatgtgatggcagaactgggtatgaccgaagggttcgacgtgggtctggagatgtcc
ggtgcgccgccagcgtttcgcacgatgctcgacaccatgaaccacggcggccgtattgcg
atgctggggattccgccgtccgatatgtctatcgactggactaaagtcatcttcaaaggg
ctgtttatcaaaggcatttacggtcgtgagatgttcgaaacctggtataagatggcggcg
ttaatccagtctggtctggatctttcgccgattattacccatcgtttcagcatcaacgag
ttccagcagggcttcgacgcgatgcgctcggggcagtccggcaaagtgattctgagctgg
gattag

DBGET integrated database retrieval system