KEGG   Enterobacter sp. R4-368: H650_19290Help
Entry
H650_19290        CDS       T02700                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
enr  Enterobacter sp. R4-368
Pathway
enr00473  D-Alanine metabolism
enr00550  Peptidoglycan biosynthesis
enr01100  Metabolic pathways
enr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:enr00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    H650_19290 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    H650_19290 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    H650_19290 (ddl)
Enzymes [BR:enr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     H650_19290 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:enr01011]
 Precursor biosynthesis
  Amino acid ligase
   H650_19290 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATP-grasp_3 ATPgrasp_YheCD TTL ATP-grasp ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AGN87180
UniProt: R9VUW1
LinkDB All DBs
Position
3881824..3882744
Genome map
AA seq 306 aa AA seqDB search
MAEKVAVLLGGTSAERDVSLNSGAAVLAGLREGGVDAHGVDPRDVDVTRLKEMGFSKAFI
ALHGRGGEDGTLQGLLELIDIPYTGSGVMASAISMDKWRSKLLWQGAGLPVAPWVALTRG
EFESGLKIIDIQRIEVLGLPVIVKPSREGSSVGMSKVDKKEELHAALALAFQHDDEVLIE
KWLCGPEFTVALLGNEILPSIRIQPAGIFYDYEAKYLSDETKYFCPSGLEADNEAALQAL
AREAWQILGCRGWGRIDVMLDSDGQFYLLEANTSPGMTSHSLVPMAARQAGLSFSQLVVR
ILELAE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtggctgagaaagtagcggttctgctgggcggaacctccgccgagcgtgacgtttcgctt
aattccggtgcagcggtgctggcaggtttgcgtgaaggcggtgttgatgcgcatggtgtg
gatccgcgcgatgtggatgtcacccgcctgaaagagatggggttcagtaaagcgtttatc
gccctgcatggccgcggcggcgaagatggtactctgcaggggctgctggaattaattgat
attccctacaccggaagcggtgtgatggcctcggcgatttcgatggataaatggcgcagc
aagctgttgtggcaaggggcagggttgcccgtcgcgccgtgggtagcactgacgcgcggc
gaatttgaatcaggcctgaaaattattgatattcaacggattgaggtgctggggttacct
gttattgtcaagcccagccgcgaaggctcaagcgtcgggatgtcaaaggtcgataaaaaa
gaagaactgcatgcagcattagcgcttgcatttcaacatgatgatgaagttctgatcgaa
aaatggctctgtgggccggaatttaccgtcgcattgcttggaaatgaaattttaccgtcg
attcgtattcaaccggcgggaatcttctatgattatgaggcgaaatatctctctgatgag
acgaagtatttttgcccatcaggtctggaagcggacaatgaagcagcattacaagccctg
gcgcgtgaagcctggcaaattttaggctgtcgtggctggggccgtattgatgtcatgctg
gacagcgatggacagttttatttgctggaagcgaacacgtcgccaggaatgaccagccat
agtctggtgccgatggcggcacgtcaggcggggctgagtttctcccagttagttgttcgc
attctggaattggcggagtga

DBGET integrated database retrieval system