KEGG   Enterobacter sp. R4-368: H650_20355Help
Entry
H650_20355        CDS       T02700                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
enr  Enterobacter sp. R4-368
Pathway
enr00730  Thiamine metabolism
enr00790  Folate biosynthesis
enr01100  Metabolic pathways
enr02020  Two-component system
Module
enr_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:enr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    H650_20355
   00790 Folate biosynthesis
    H650_20355
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    H650_20355
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:enr04147]
    H650_20355
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:enr00537]
    H650_20355
Enzymes [BR:enr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     H650_20355
Exosome [BR:enr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   H650_20355
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:enr00537]
 Enzymes
  H650_20355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest
Motif
Other DBs
NCBI-ProteinID: AGN87381
UniProt: R9VSX7
LinkDB All DBs
Position
4115136..4116566
Genome map
AA seq 476 aa AA seqDB search
MENIKVKQSALFLALLPLMFTPAIYAETTSAPVLDNRAAHGDISTPGGARRLSGDQTAAL
RDSLMDKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYSLDKKT
GKPDYVTDSAASATAWSTGVKTYNGALGVDIHDKDHTTILEMAKAAGLATGNVSTAELQD
ATPAALVSHVISRRCYGPTVTSEKCALNALEKGGKGSITEQLLNARADVTLGGGAKTFSE
TATAGEWKGKTLREQAQARGYQLVGDASSLAAISEANQDKPLLGLFSDGNMPVRWEGPKA
SLHGNIDKPAVTCTPNAKRTDSIPTLAAMTEKAIDLLSKNEKGFFLQVEGASIDKQDHAA
NPCGQIGETVDLDEAVQKALEFAKKDGNTLVIVTADHAHASQIIPADTKAPGLSQALNTK
DGAVMAITYGNSEEESMEHTGTQVRIAAYGPHAGNVVGLTDQTDLFYTMKAALNLK
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggagaatattaaagtgaaacagagcgcattatttcttgcattattacctctgatgttt
acccctgctatttatgccgaaacgacgtcggcaccggttcttgataatcgtgctgctcac
ggcgatatttccacgcctggtggtgcgcgccgtttaagcggtgaccaaaccgctgctctg
cgtgattccctcatggataagcccgccaaaaatattattttgctgattggcgatggcatg
ggggattccgaaattaccgccgcgcgaaattacgccgaaggggccggtggattttttaaa
ggtattgacgcactgccgctgaccggccagtacacacactattcgctggacaaaaaaacc
ggcaagccggattacgtcaccgattccgccgcgtcggccacggcctggagcaccggcgtg
aaaacctataacggtgcgctcggcgtcgacattcacgataaagatcacaccaccattctg
gagatggccaaagccgccggtctggcgacgggcaacgtttccactgcggaactgcaagac
gctacgcccgccgcgctggtttctcacgttatctcacgccgctgctacggcccgacggtg
accagtgagaaatgtgcgcttaacgcgctggagaaaggcggtaaagggtcgattaccgaa
caactgctgaacgcccgcgcggatgtcactttgggcggcggcgcgaaaacctttagcgaa
accgcgaccgctggtgagtggaaagggaaaacgctgcgtgaacaggcgcaggcgcgcggc
taccagctggtcggtgatgcctcttcgctggcggcgatcagcgaagctaaccaggataaa
ccgctgctggggctgttctctgacggcaatatgccggtgcgctgggaagggccaaaagcc
tcgctgcacggcaatattgataaacctgccgtgacctgtacgcccaacgcgaaacgcacc
gacagcataccaacactggcggcgatgacggaaaaagctattgatttgctcagcaaaaat
gagaaaggcttcttcctgcaagtggaaggcgcgtcgatcgataaacaggatcacgcggcg
aacccgtgcggtcagatcggtgaaacggttgatctcgacgaagctgtgcagaaagcgctg
gaatttgccaaaaaagatggcaatacgctggtgatcgtgacggcggatcatgcccacgcc
agccagatcattccggcagataccaaagcgccaggcttaagccaggcactgaacaccaaa
gacggcgcggtaatggccatcacttacggcaactcggaagaggagtcgatggaacatacc
ggaacgcaggttcgcatcgcggcttacggcccgcatgcgggcaacgtggtggggctgaca
gatcagaccgatctgttctacaccatgaaagcagctctgaatctgaagtaa

DBGET integrated database retrieval system