KEGG   Enterobacter sp. R4-368: H650_21900Help
Entry
H650_21900        CDS       T02700                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
enr  Enterobacter sp. R4-368
Brite
KEGG Orthology (KO) [BR:enr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    H650_21900
Enzymes [BR:enr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     H650_21900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored NAD_binding_8 Thi4 FAD_binding_3 Glutaredoxin K_oxygenase AlaDh_PNT_C FMO-like DAO
Motif
Other DBs
NCBI-ProteinID: AGN87684
UniProt: R9VRF7
LinkDB All DBs
Position
4438374..4439939
Genome map
AA seq 521 aa AA seqDB search
MLDTTMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLGEIAELSDKVSFKEDNSLAV
RKPSFLITNPGSHNGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQALLEQIRDLDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQNEITDRNVMGVPAVFVNGQE
FGQGRMTLTEIVAKIDTGAEKRAAEELNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYNVDVIDSQSASKLVPAAVEG
GLHQIETASGAVLKARSIIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVKGD
GSKVTGLEYRDRVSGDVHSVALAGIFVQIGLLPNTTWLEGAIERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSSFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacactactatgaaaacccaactcaaggcctaccttgagaaactgactaaacct
gttgagctgattgctacgctggatgacagcgcgaaatcggcagaaatcaaagaactgctg
ggcgaaatcgctgaactgtcagacaaggtctcctttaaagaagacaatagcctggcggtg
cgtaaaccgtcgttcctgatcactaaccctggctcgcataacggcccgcgttttgccggt
tcgccgctgggtcacgaatttacttctctggtgctggcgctgctgtggaccggtggtcat
ccgtcaaaagaggcgcaggcgctgcttgagcagatccgcgatctggatggcgattttgag
tttgaaacctactattcgctctcctgccataactgcccggacgtggtgcaggcgctgaac
ctgatggcggtgctgaacccgcgcattaaacacacggcgattgatggcggtacgttccag
aacgaaatcaccgatcgtaacgtgatgggtgtgccggccgtgttcgttaacggccaggag
ttcggtcaggggcgtatgacgctgaccgaaattgtcgccaaaattgataccggtgcggaa
aaacgcgcggcggaagagctgaacaagcgtgacgcttacgacgtgctgattgtcggttcc
ggcccggcgggtgcggcggcggcggtttactcagcgcgtaaaggcattcgtaccggcctg
atgggcgagcgtttcggcggccaggtactggataccgtggatattgaaaactacatttct
gtgccgaaaacagaaggccagaaactggcgggcgcgctgaaagcgcacgtctcggattac
aacgtcgatgtgattgacagccagagcgccagcaaactggtgcctgcggcggtggaaggc
ggtctgcaccagattgaaaccgcgtcaggcgcggtactgaaagcgcgcagcattatcatt
gccaccggcgcgaaatggcgcaacatgaatgtgccgggcgaagatcaataccgcaccaaa
ggtgtgacttactgcccgcactgcgacggcccgctgtttaaaggcaaacgcgtggcggtg
atcggcggtggtaactccggtgtggaagcggctatcgatctggcggggattgtcgagcac
gtaacattgcttgaattcgccccggaaatgaaagctgaccaggtgttgcaggacaaagtg
cgcagcctgaaaaacgtcgacattattctgaacgcgcagactaccgaagtgaaaggcgac
ggcagcaaagtgaccggccttgagtaccgcgaccgtgtgagcggcgatgttcacagcgtg
gcgctggcagggatttttgtgcagattggtctgctgccgaacaccacctggctggaaggc
gcgattgagcgcaaccgcatgggcgaaattattatcgacgcgaaatgcgaaaccagcgtg
aaaggcgtgtttgccgccggtgactgcaccacggtgccgtacaaacagatcattattgcc
acgggtgaaggtgccaaagcctctctgagttcctttgactaccttatccgcacgaaaact
gcgtaa

DBGET integrated database retrieval system