KEGG   Enterobacter sp. 638: Ent638_0190Help
Entry
Ent638_0190       CDS       T00507                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ent  Enterobacter sp. 638
Brite
KEGG Orthology (KO) [BR:ent00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ent03012]
    Ent638_0190
   03029 Mitochondrial biogenesis [BR:ent03029]
    Ent638_0190
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ent04147]
    Ent638_0190
Translation factors [BR:ent03012]
 Eukaryotic Type
  Elongation factors
   Ent638_0190
 Prokaryotic Type
   Ent638_0190
Mitochondrial biogenesis [BR:ent03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Ent638_0190
Exosome [BR:ent04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Ent638_0190
  Exosomal proteins of breast cancer cells
   Ent638_0190
  Exosomal proteins of colorectal cancer cells
   Ent638_0190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Lsm_C
Motif
Other DBs
NCBI-ProteinID: ABP58880
UniProt: A4W5A0
LinkDB All DBs
Position
220840..222024
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARG
ITINTSHVEYDTPSRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPFIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIIRGSALKALE
GEAEWEAKIVELAGYLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIVKVG
EEVEIVGIKETAKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGSIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIQMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVIS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgtacaaaaccgcacgttaacgtcggtactatcggccac
gttgaccatggtaaaacaacgctgactgctgcaatcactaccgttctggcgaaaacctac
ggtggttctgctcgtgcattcgatcagatcgataacgcaccagaagaaaaagctcgtggt
atcaccatcaacacttcccacgttgaatatgacaccccgtcccgccactacgcacacgta
gactgcccgggccacgccgactatgttaaaaacatgatcaccggtgctgctcagatggat
ggcgcgatcctggttgttgctgcgactgatggtcctatgccacagacgcgcgagcacatc
ctgctgggtcgtcaggtaggcgttcctttcatcatcgtgttcctgaacaaatgcgacatg
gttgatgacgaagagctgctggaactggtcgaaatggaagtgcgtgaacttctgtctcag
tacgatttcccaggtgatgatactccaatcatccgtggttctgctctgaaagcgctggaa
ggcgaagcagagtgggaagctaaaatcgttgaactggctggctacctggattcttacatc
ccggaaccagaacgtgcaatcgacaagccattcctgctgccaatcgaagacgtattctcc
atctccggccgtggtactgttgtaaccggtcgtgtagagcgcggtatcgttaaagttggc
gaagaagttgaaatcgttggtatcaaagagactgctaagtctacctgtactggcgttgaa
atgttccgcaaactgctggacgaaggccgtgctggtgagaacgttggtgttctgctgcgt
ggtattaaacgtgaagaaatcgaacgtggtcaggtactggctaagccaggctcaatcaag
ccgcacaccaaattcgaatctgaagtttatattctgtccaaagatgaaggcggccgtcat
actccgttcttcaaaggctaccgtccacagttctacttccgtacaactgacgtgaccggt
accatcgaactgccagaaggcgtagagatggtaatgcctggcgacaacattcagatggtt
gttaccctgatccacccaatcgcgatggatgacggtctgcgtttcgcaatccgtgaaggc
ggccgtactgtaggcgctggcgttgtagctaaagttatcagctaa

DBGET integrated database retrieval system