KEGG   Enterobacter sp. 638: Ent638_0268Help
Entry
Ent638_0268       CDS       T00507                                 

Definition
(GenBank) Glutathione S-transferase, N-terminal domain
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ent  Enterobacter sp. 638
Pathway
ent00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ent00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Ent638_0268
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ent02000]
    Ent638_0268
Enzymes [BR:ent01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Ent638_0268
Transporters [BR:ent02000]
 Other Transporters
  Pores ion channels [TC:1]
   Ent638_0268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 Tom37
Motif
Other DBs
NCBI-ProteinID: ABP58957
UniProt: A4W5H7
LinkDB All DBs
Position
314914..315579
Genome map
AA seq 221 aa AA seqDB search
MLTLHHLNQSRSQRVIWALEELGVPYQIVRYQREKTMLAPPSLKKIHPLGKSPVVEDNGL
ILAESGAILEYLQETYDPESHLKPQDAAHKTQYRFWLHYAEGSLMPLLMMKLVFNSLGKP
PVPFGLRTLGNLLAQGVQKGYLNGQIETHARFVESHLAENSWFAGDHLSMADIQMSFPVF
ALLARGGVDNLPHLHAWKKKVEMRPAWQRAIQQGGPFEIPG
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgctcacgctccaccacttgaatcaatcccgctcacagcgcgtgatctgggcgctcgaa
gaactcggcgtgccgtatcaaattgtccgctatcagcgcgaaaaaaccatgctggcgccg
ccgtcgctcaagaaaatccacccgctgggtaaatcgcctgtagtagaagataacggcctg
atcctcgcggaatcgggggcaattcttgaatacttgcaagaaacctatgatccggagtca
catcttaaacctcaggatgcggcgcataaaacccagtatcgcttctggctgcattacgca
gaagggtcgctgatgccgcttctgatgatgaaactggtctttaatagtctgggcaaaccg
ccggtgccttttggtctgcgaacattgggtaacttgctggcacaaggcgtacagaaaggc
tatctcaacggtcagattgaaacgcacgcgcgttttgtcgaatcgcatctggccgagaac
agctggttcgcaggcgatcatctcagcatggcggatattcagatgagcttcccggtattc
gcgttacttgcgcgcggtggagtcgacaacctgccgcatctacacgcatggaagaaaaag
gtcgaaatgcgccccgcgtggcaacgtgcgattcagcagggtgggccgtttgaaatcccc
ggataa

DBGET integrated database retrieval system