KEGG   Enterobacter sp. 638: Ent638_0689Help
Entry
Ent638_0689       CDS       T00507                                 

Definition
(GenBank) penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
ent  Enterobacter sp. 638
Pathway
ent00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ent00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Ent638_0689
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ent01003]
    Ent638_0689
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ent01011]
    Ent638_0689
Enzymes [BR:ent01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Ent638_0689
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Ent638_0689
Glycosyltransferases [BR:ent01003]
 Polysaccharide
  Bacterial polysaccharide
   Ent638_0689
Peptidoglycan biosynthesis and degradation proteins [BR:ent01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   Ent638_0689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PBP1_TM UB2H UvrB_inter DUF3484 DUF4106
Motif
Other DBs
NCBI-ProteinID: ABP59376
UniProt: A4W6P6
LinkDB All DBs
Position
781249..783774
Genome map
AA seq 841 aa AA seqDB search
MAGNDREPIGRKGKPARPAKEKVSRRRLRDEDYDDDYEDDDEDQEPMPRNGKGKGRKPRG
RRGWFWLLLKLFIVFVALMAIYGVYLDQKIRSRIDGKVWQLPAAVYGRMVNLEPDMSISK
NEMVKLLEATQYRQVTKMTRPGEFTVQAKSIEMIRRPFDFPDSKEGQVRARLTFDGDHLE
TIENLESNRQFGFFRLDPRLITMLSSPNGEQRLFVARNGFPDLLVDTLLATEDRHFYEHD
GVSLYSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSERSYWRKANEAYMAVLMDARY
SKDRILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVEELSLDQQALLVGMVKGASIYN
PWRNPKLALERRNLVLRLLQQQQVIDQELYEMLSARPLGVQPRGGVISPQPAFMQMVRQE
LQTKLGDKVKDLSGVKIFTTFDSVAQDAAEKAAVDGIPVLKKQRKLSDLETAMVVVDRNT
GEVRAMVGGAEPQYAGYNRAMQARRSIGSLAKPATYLTALSQPNQYRLNTWIADAPIALR
QPNGQVWSPQNDDKQFSGQVMLVDALTRSMNVPTVNLGMALGLPAITDTWQKLGVAKDQL
HPVPAMILGALNLTPIEVAQAFQTIASGGNRAQLSSLRSVIAEDGSVLYQSFPQAERAVP
AQAAYMTLWTMQQVVQRGTGRQLGAKYPGLHLAGKTGTTNNNVDTWFAGIDGREVVITWV
GRDNNQPTKLYGASGAMSIYQRYLANQSPVPLNLTAPEDIVDMGVDDAGNFVCGGGVRAL
PVWTTDPDSLCQQNPTQQPTGNPFEQPSQPQQPQQQQPQQQNEKKDSDGVAGWIKDMFGS
N
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
atggcggggaatgaccgcgagccaattggacgtaagggtaaacctgcgcgtccggcgaag
gaaaaagtgagccgtcgtcgcctcagagatgaggattatgacgatgactatgaagacgat
gatgaggatcaagaacccatgccgcgtaatggtaaaggcaaagggcggaagcctcgtgga
cgacgcggctggttctggctgctgctgaagctgtttattgtatttgttgccctgatggcg
atttacggcgtctacctggatcaaaagatccgcagccgtatcgacggtaaagtctggcag
ctgcctgcggcggtgtatggtcgcatggtgaaccttgagccggacatgtccatcagtaag
aacgaaatggtcaaactgctggaagcgacacagtatcgtcaggtgacgaagatgacgcgt
cccggcgagtttaccgtgcaggcgaaaagcatcgagatgatccgtcgtccgtttgatttc
ccggacagtaaagaagggcaggtgcgcgcgcgtctgacctttgacggcgatcatctggaa
acaatcgagaacctcgaaagcaaccgtcagttcggtttcttccgcctcgatccgcgtctg
atcaccatgctttcatcgccaaacggtgagcagcgtctgtttgtggcgcgtaacggcttc
ccggatctgctggtggatacgttgctggcgacggaagaccgtcacttctacgagcacgac
ggcgtgagtttgtactctattggccgtgcggtgctggcgaacctgacggccggacgtacg
gtgcagggggcgagtaccctgacgcagcagctggttaaaaacctgttcctctccagcgag
cgctcttactggcgtaaggctaacgaagcgtacatggccgtgctgatggacgcccgctac
agcaaagatcgtattcttgagctgtatatgaacgaggtgtatctcggtcagagcggcgat
aacgagattcgcggtttcccgctggcgagcctgtattactttggtcgcccggtggaagag
ctgagtctcgatcagcaggcgttgctggtaggtatggtgaaaggcgcgtcaatctataat
ccgtggcgcaacccgaaactggcgctggagcgtcgtaatctggtcctgcgtttgctgcaa
caacagcaggttatcgatcaggaactttacgagatgctgagtgcgcgtccgctgggcgtt
cagccgcgcggtggggtgatctctccgcagcctgcgtttatgcagatggtgcgtcaggag
ctgcaaaccaagcttggcgataaagtgaaagatctctccggcgtgaagatctttaccacg
ttcgactcggtggcgcaggatgccgctgagaaagccgccgttgatggcattccggtgctg
aaaaagcagcgtaagctgagcgatctggaaaccgcgatggtggtggtcgatcgtaacacc
ggtgaagtgcgtgcgatggtcggcggcgcggagccgcaatacgcgggctacaaccgcgcg
atgcaggcgcgtcgttcgattggttctctggcaaaaccggcgacctatttgaccgcactg
agccagccgaatcagtatcgactgaacacctggattgccgatgcaccgattgccctgcgc
cagcctaacggccaggtgtggtcgccgcagaacgatgataaacagttcagcggtcaggtg
atgctggtggatgcgctgacccgttccatgaacgtgccaaccgttaaccttggtatggcg
ctgggtctgcctgcgattacggatacctggcagaagctgggcgtggcgaaagatcagctg
catccggttcctgcgatgattctgggcgcgttgaacctgacgccaatcgaagtggcgcag
gcgttccagaccatcgccagcggcggtaaccgtgcgcaactctcttcgctgcgttcagtg
atcgcagaagacggatcggtgctgtatcagagcttcccgcaggcagagcgtgcggtgcct
gctcaggccgcatatatgacgctgtggaccatgcagcaggttgtgcagcgcggtacgggt
cgccagcttggcgcgaaatatccgggtctgcatctggcgggtaaaaccgggaccaccaac
aataacgtcgatacctggtttgccgggattgacgggcgcgaagtggtgatcacctgggtt
ggccgcgataacaaccagccgaccaagctgtacggtgcgagcggggcgatgtcgatttat
cagcgctatctggctaatcagtctccggttcctctgaacctgactgcgccagaagatatc
gtcgatatgggcgtggatgatgctggtaacttcgtgtgcggcggcggggtgcgcgccttg
cctgtctggacgactgacccggattcgctgtgccagcaaaacccaacgcagcaaccgacg
ggcaatccgtttgagcagccttcgcaacctcagcagccgcagcaacaacagccgcagcag
cagaatgagaagaaagacagcgacggcgtcgcgggctggatcaaagatatgttcggcagc
aattaa

DBGET integrated database retrieval system