KEGG   Enterobacter sp. 638: Ent638_0718Help
Entry
Ent638_0718       CDS       T00507                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
ent  Enterobacter sp. 638
Pathway
ent00061  Fatty acid biosynthesis
ent00780  Biotin metabolism
ent01100  Metabolic pathways
ent01212  Fatty acid metabolism
Module
ent_M00083  Fatty acid biosynthesis, elongation
ent_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:ent00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Ent638_0718
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Ent638_0718
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ent01004]
    Ent638_0718
Enzymes [BR:ent01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     Ent638_0718
Lipid biosynthesis proteins [BR:ent01004]
 Fatty acid synthase
  Component type
   Ent638_0718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH
Motif
Other DBs
NCBI-ProteinID: ABP59405
UniProt: A4W6S5
LinkDB All DBs
Position
817586..818041
Genome map
AA seq 151 aa AA seqDB search
MTTDTHTLHIEEILELLPHRYPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPGKPI
FPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKT
RRGLTRFKGVASVDGKVVCEATMMCARSREA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgactaccgacactcatactctgcatattgaagagattttagaacttctgccgcaccgc
tacccgtttttgctggtagatcgtgtgctggattttgaagaaggtcgttttctgcgcgca
gtgaaaaatgtttcagtaaatgagccattcttccagggacatttccctggtaagcctatc
ttcccgggtgtgttgatcctggaagcgatggcacaggctacgggtattctcgcgtttaaa
agcgtgggcaaacttgagccaggtgagttgtattacttcgcgggtattgatgaagcgcgc
tttaagcgcccagtcgtacctggtgatcagatgatcatggaagtgacttttgaaaaaacg
cgccgtggactgacgcgcttcaaaggcgttgcttcagttgacggcaaagttgtttgtgaa
gctaccatgatgtgtgcgcgtagccgggaggcctga

DBGET integrated database retrieval system