KEGG   Enterobacter sp. 638: Ent638_0844Help
Entry
Ent638_0844       CDS       T00507                                 

Definition
(GenBank) beta-lactamase
  KO
K18988  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase [EC:3.4.16.4 3.4.21.-]
Organism
ent  Enterobacter sp. 638
Brite
KEGG Orthology (KO) [BR:ent00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ent01002]
    Ent638_0844
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ent01011]
    Ent638_0844
Enzymes [BR:ent01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Ent638_0844
   3.4.21  Serine endopeptidases
    3.4.21.-  
     Ent638_0844
Peptidases and inhibitors [BR:ent01002]
 Serine peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   Ent638_0844
Peptidoglycan biosynthesis and degradation proteins [BR:ent01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   Ent638_0844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: ABP59528
UniProt: A4W748
LinkDB All DBs
Position
complement(943005..944171)
Genome map
AA seq 388 aa AA seqDB search
MLSLKRCLFSIAALCAVSLSTVQAAQPITAPVFASDIADRYANLIYYGSGATGMAMVVID
GNQRVFRSFGETRPGNNVHPQLDSVIRIASLTKLMTSEMLVKLLDQGVVKLNDPLSKYAP
PGYRVPTYQGTPISLVNLATHTSALPREQPGGAAHRPVFVWPTREQRWTYLTTATLKTAP
GAQAAYSNLAFDLLADALATASGKPYPQLFEDNITRPLGMKDTTFTPSPDQCKRLMVAEK
GASPCNNTLAAIGSGGVYSTPGDMMRWMQQFLSSDFHARSNQADRMQTLIYKRNQLTRVI
GMDVPGKADALGLGWVYMAPKDGRPGIIQKTGGGGGFITYMAMIPQSNVGAFVVVTRSPN
TRFTNMSDGINNLVAELSENKAKVIPAS
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgctttcgttgaaacgttgtctgttttccattgccgcgctgtgtgcggtaagcctctcc
acagttcaggctgctcagccgatcacggcccccgtttttgcctccgacattgcggatcgt
tacgccaatctgatttattacggcagcggtgccaccggcatggcaatggtcgtgattgac
ggcaaccagcgcgtattccgcagctttggcgaaacgcgaccgggtaacaatgtccatccg
cagctggattccgtgatccgcattgcatcgctaacgaagctgatgaccagcgaaatgctg
gtgaaactgctcgatcaaggcgtggtaaaactcaacgatcccttaagcaaatatgctccg
ccgggttatcgcgtcccgacatatcagggcacacctatttctctggtgaatctggcaacg
cataccagcgcgctgccgcgtgagcagccaggcggtgcagcgcatcgtcctgttttcgtc
tggcccacgcgcgaacagcgctggacctacctgacgacagcgacgctgaaaaccgcgccg
ggcgcacaggcggcctattcaaacctggcatttgatttactcgccgatgcgttagccaca
gcatccggcaagccctatccgcagctgtttgaagacaacatcacccgtccgctgggcatg
aaggacaccacttttacgccgtcaccggatcagtgcaaacgcctgatggtggcggaaaaa
ggggccagcccgtgtaacaacaccctcgcggccatcggcagcggcggcgtttactccacg
cctggcgatatgatgcgctggatgcagcagttcctgtcgtctgatttccacgcgcgcagc
aatcaggctgaccgcatgcaaacgctcatctacaaacgcaaccagctgacccgcgttatc
ggtatggacgtgccgggtaaagccgatgcgcttggcctgggctgggtgtacatggcacca
aaagatggccgccctggcattattcagaaaacgggtggtggtggcggattcattacctac
atggcgatgatcccgcagtccaatgtcggggcattcgtggtcgtgactcgctcaccgaat
acccgtttcaccaacatgagcgacgggattaataatttggtcgctgaactgagcgagaat
aaggcgaaagtgatccccgcctcttga

DBGET integrated database retrieval system