KEGG   Enterobacter sp. 638: Ent638_0850Help
Entry
Ent638_0850       CDS       T00507                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ent  Enterobacter sp. 638
Pathway
ent00473  D-Alanine metabolism
ent00550  Peptidoglycan biosynthesis
ent01100  Metabolic pathways
ent01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ent00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Ent638_0850
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Ent638_0850
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Ent638_0850
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ent01011]
    Ent638_0850
Enzymes [BR:ent01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Ent638_0850
Peptidoglycan biosynthesis and degradation proteins [BR:ent01011]
 Precursor biosynthesis
  Amino acid ligase
   Ent638_0850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST ATP-grasp_3 ATP-grasp_4 RimK GARS_A NHase_alpha
Motif
Other DBs
NCBI-ProteinID: ABP59534
UniProt: A4W754
LinkDB All DBs
Position
complement(948122..949222)
Genome map
AA seq 366 aa AA seqDB search
MAKQRVGIVFGGKSAEHEVSLQSAKNIVDAIDKSRFDVVLLGIDKQGQWHVNDASQYLLN
ADDPAHIALNPSEISVATVPGVIHGQLINAGNAQTLAQIDVIFPIVHGTLGEDGSLQGML
RMANLPFVGSDVLGSAACMDKDVTKRLLRDAGLNIAPFVTLTRANRDQHSFAQITAQLGL
PLFVKPANQGSSVGVSKVTSEAQFADAVRLAFEFDHKVVVEQGIKGREIECAVLGNDFPQ
ASTCGEVVLNSDFYSYDTKYIDDKGAQVVVPAVLDPEINDKIRAIAIEAYQALGCGGMAR
VDVFLTAENDVIINEINTLPGFTNISMYPKLWQASGISYPELITRLIELALERHTADSAL
KSSVNG
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcagcgggtaggaattgtctttgggggaaaatcagcagaacacgaagtgtcg
ctgcaatcggctaaaaatatcgtggatgcgattgataaaagccgctttgacgtggtcctg
ctgggcattgataagcaaggccaatggcatgtcaacgatgccagccagtatctgctgaat
gcagacgacccggcgcatatcgcgctcaatccttcagaaatcagcgtggcgaccgtgcct
ggcgtcatccacggccagctgatcaacgcgggcaatgcccaaacgttggcgcagattgat
gtcattttcccgattgttcacggcacgttgggcgaagatggctccctgcaagggatgctg
cgcatggctaacctgccgtttgtcggctcagacgtgctcggctccgccgcctgcatggat
aaagatgtcactaagcgcttgctgcgtgacgccggtctgaacattgcgccgtttgtgacc
ctgacccgtgccaaccgcgatcagcacagtttcgcccagatcaccgcccagcttggcctg
ccgctatttgtgaaacccgccaaccaaggttcatccgttggcgtcagtaaagtgaccagc
gaagcgcaattcgcagacgcagtacgcctggcattcgaattcgatcataaagtggtggtt
gagcaaggcattaaaggtcgcgaaatcgaatgcgccgttttaggcaacgatttcccacag
gccagcacctgcggtgaagtggttctgaacagtgatttttactcttacgacaccaaatat
attgatgataaaggcgcgcaggtcgtggtgccggccgtcctggatcctgaaatcaacgac
aagatccgtgcgatcgccatcgaggcgtatcaggcgctcggctgcggcggtatggcgcgt
gtcgatgtgttcctgacggcagaaaatgacgttattattaacgaaatcaacacgctgcct
ggcttcaccaacatcagcatgtatccaaaactctggcaggccagcgggatcagctatcca
gagctaatcacccgtcttatcgaactggcgctggagcgacacaccgccgacagcgccctg
aaaagctcagtaaacggttaa

DBGET integrated database retrieval system