KEGG   Enterobacter sp. 638: Ent638_0854Help
Entry
Ent638_0854       CDS       T00507                                 

Definition
(GenBank) Alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
ent  Enterobacter sp. 638
Pathway
ent00730  Thiamine metabolism
ent00790  Folate biosynthesis
ent01100  Metabolic pathways
ent02020  Two-component system
Module
ent_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ent00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Ent638_0854
   00790 Folate biosynthesis
    Ent638_0854
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ent638_0854
Enzymes [BR:ent01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Ent638_0854
Exosome [BR:ent04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ent638_0854
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ent00537]
 Enzymes
  Ent638_0854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest PT-VENN
Motif
Other DBs
NCBI-ProteinID: ABP59538
UniProt: A4W758
LinkDB All DBs
Position
952007..953422
Genome map
AA seq 471 aa AA seqDB search
MKQSALFIALIPLLFTATSHAETTDTHVLDNRAAHGDITQPGGARRLSEDQTAAIRASLN
DKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYALDKKTGKPDY
VTDSAASATAWTTGVKSYNGALGVDIHEKDHQTILEMAKAAGLSTGNVSTAELQDATPAA
LVAHVTSRKCYGPIATSEKCPSNALEKGGKGSITEQLLNARADVTLGGGAKTFAETATAG
DWQGKTLREQAQARGYQMVSDATSLAAITEANQDKPLLGLFSDGNMPVRWEGPKASYHGN
LDKPVVTCAPNPKRNDSIPTLAQMTDKAITLLNKGDKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQKALEFAKKDGNTLVVVTADHAHASQIVAPDTKAPGLTQALNTKDGAVM
VMSYGNSEEDSMEHTGSQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacagagcgcactattcatcgcattaattccgttgttattcaccgcaacgtcacac
gccgaaaccaccgatacccacgtcctggacaatcgtgctgcgcacggggatatcacccaa
cctggcggtgctcgccgtttgtcggaagatcaaaccgcggctatccgcgcatcgcttaat
gataaaccggctaaaaatattattctgttaattggcgacggcatgggggattccgaaatt
accgccgcgcgcaattatgccgagggcgcgggtggtttctttaaaggcatcgatgcgttg
ccgttgaccgggcaatatacccattacgcactggacaaaaaaaccggcaagccggattac
gtgaccgactctgcggcttctgcaacggcctggaccaccggggttaaatcgtataacggc
gcgctgggcgtcgatattcacgaaaaagatcaccagaccattctggagatggcaaaagcc
gcagggctttcaacggggaacgtctccacggctgagcttcaggatgccacccctgccgcg
ctggtggcgcatgtgacgtcgcgtaaatgctacggcccgatcgcgaccagcgaaaaatgc
ccgtctaacgcgctggaaaaaggcggtaaaggctctatcaccgagcagcttctgaatgcg
cgcgctgatgtcaccctgggcggaggggcgaagactttcgccgaaaccgcaacagcgggt
gactggcagggcaaaacgctgcgcgagcaggcgcaggctcggggctatcagatggtgagc
gacgccacctctctggcggcgattaccgaagcaaatcaggataaaccgctgcttggcctg
ttctcggacgggaatatgccggtgcgctgggaagggccaaaagcctcttatcacggtaac
ctcgacaagcctgtggtcacctgtgcgccgaatccgaaacgcaatgacagcatcccgacg
ctggcgcagatgacggataaagccatcaccctgctaaacaaaggcgataagggcttcttc
ctgcaggtagaaggcgcgtcgatcgataaacaggatcacgcagcgaatccgtgcggtcag
attggcgaaacggtcgatctggatgaagcggtgcaaaaggcgctggagtttgcgaagaaa
gacggcaacaccctggtggtggttacggctgaccacgctcacgccagccaaatcgtagcg
ccagataccaaagcgccgggcctgactcaggcgctgaacaccaaagacggtgcggtgatg
gtgatgagttatggcaactccgaagaagactcgatggaacatactggctcgcagctacgc
attgcggcgtatggtcctcatgccgcaaacgtggtaggtctgacggatcaaaccgatctg
ttctacaccatgaaagcggcactcggactgaaataa

DBGET integrated database retrieval system