KEGG   Enterobacter sp. 638: Ent638_1146Help
Entry
Ent638_1146       CDS       T00507                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulfide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ent  Enterobacter sp. 638
Brite
KEGG Orthology (KO) [BR:ent00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Ent638_1146
Enzymes [BR:ent01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Ent638_1146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored NAD_binding_8 Thi4 FAD_binding_3 Glutaredoxin K_oxygenase AlaDh_PNT_C FMO-like DAO
Motif
Other DBs
NCBI-ProteinID: ABP59827
UniProt: A4W7Z7
LinkDB All DBs
Position
1260913..1262478
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDSARSAEIKELLAEIAELSPKVTFKEDNSLAV
RKPSFLITNPGSDQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQTLLEQIRDIDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGVFQNEITERNVMGVPAVFVNGKE
FGQGRMTLTEIVAKIDTGAEKRAAEELNKRDVYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVDDYDVDVIDSQSASKLVPAVTEG
GLHQIETASGAVLKARSVIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGLVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIVLNAQTTEVKGD
GSKVTGLEYRDRVSGDVHNVALSGIFVQIGLLPNTTWLEGAIERNRMGEIMIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaccaacatgaaaacccagctcaaggcctaccttgagaaactgaccaaacct
gttgagttgattgccacgctggatgacagcgcaagatcggcagaaatcaaggaactgctg
gcggaaatcgccgaactgtcaccaaaagtgacctttaaagaagacaacagcctggcggtg
cgtaagccgtcattcctgattaccaatccaggttctgaccagggcccgcgttttgctggt
tctccgttggggcacgaatttacctcgctggtgctggcgctgctgtggaccggtggtcat
ccatcgaaagaagcccagacgctgctggagcaaatccgcgatatcgatggcgatttcgag
tttgaaacgtactactcgctctcatgccacaactgcccggacgtggtgcaggctctgaac
ctgatggccgtgctgaacccgcgtattaagcacactgcgattgacggcggcgtgttccag
aatgaaatcaccgaacgtaatgtgatgggcgttccggcggtgtttgtgaacgggaaagag
tttggtcagggtcgtatgacgctgaccgaaatcgtggccaaaattgataccggcgcggaa
aaacgcgcggcggaagagctcaacaagcgtgatgtttacgacgtgctgatcgtcggttcc
ggcccagcgggtgctgcggcagcggtgtactctgcacgtaaagggattcgtaccggcctg
atgggcgagcgctttggcggccaggttctggataccgtggatatcgaaaactacatttcc
gtgccaaaaactgaaggccaaaagctggcgggcgcactgaaagcgcacgtcgatgattat
gatgtcgatgtgatcgatagccaaagcgccagcaaactggttccggctgtgacagaaggc
ggtttgcatcagattgaaacggcttccggtgcggtactaaaagcgcgcagcgtgatcatc
gcgacgggcgcgaaatggcgcaacatgaacgtgccgggcgaagatcagtatcgcaccaaa
ggcgtcacctactgtccgcactgcgacggcccgctgtttaaaggcaaacgcgtggcggtg
atcggcggtggtaactccggtgtggaagcggccattgatctggcgggactcgttgagcac
gtcacgctgctggaatttgcccctgaaatgaaagcggaccaggtattacaggataaagtc
cgcagcctgaaaaacgtcgatatcgttctgaatgcgcagaccacggaagtgaaaggcgac
ggcagtaaagttaccggtctggaataccgtgaccgcgtgagcggtgatgtacacaacgtg
gcgctgtcaggcattttcgtgcagatcggtttgctgccaaacaccacgtggctggaaggg
gcgattgagcgcaaccgcatgggcgaaatcatgattgatgccaaatgcgaaaccagcgtg
aaaggcgtctttgcggcgggtgactgtacgaccgtgccgtacaaacagattatcatcgcg
acgggcgaaggggcgaaagcgtcactcagcgcgtttgattacctgattcgcaccaaaaca
gcataa

DBGET integrated database retrieval system