KEGG   Enterobacter sp. 638: Ent638_2526Help
Entry
Ent638_2526       CDS       T00507                                 

Definition
(GenBank) Glucan 1,4-alpha-maltohexaosidase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ent  Enterobacter sp. 638
Pathway
ent00500  Starch and sucrose metabolism
ent01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ent638_2526
Enzymes [BR:ent01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Ent638_2526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C DUF1939
Motif
Other DBs
NCBI-ProteinID: ABP61195
UniProt: A4WBW5
LinkDB All DBs
Position
2724404..2725891
Genome map
AA seq 495 aa AA seqDB search
MKNPTLLQCFHWYYPTGGELWPEVTALAPNLNEIGINMIWLPPAYKGASGGYSVGYDSYD
LFDLGEFDQKGSVATKYGDKAQLLETIAALKSNDIAVLLDVVVNHKMGADEKEPIRVQRV
NEQDRTQIDDEVIECEAWTRYTFPVRAGQYSQFVWDFKCFSGIDHIENPNEDSIFKIVND
YTGEGWNDQVDNELGNFDYLMGENIDFRNHAVTEEIKYWARWVMEQTQCDGFRLDAVKHI
PAWFYKEWIEHVQEVAPKPLFIVAEYWSHEVDKLQQYIEQVEGKTMLFDAPLQMKFHEAS
RQGRDYDMSQIFTGTLVEADPFHAVTLVANHDTQPLQALEAPVESWFKPLAYALILLREN
GVPSVFYPDLFGASYEDTGGDGETYPIEMPIIEQLHELILARQRFAHGVQTLYFDHPNCI
AFSRSGTDEEPGCVVVLSNGDEGEKVICLGENYGNKSWRDFLGNREETVTTAADGEGTFT
CNGGSVSIWVMEDVL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcccacgctattacaatgttttcactggtattaccccaccggcggtgaattg
tggccggaagtgactgccctggctcccaatcttaatgaaatcggcatcaatatgatttgg
ctgccccccgcttacaaaggcgcatcgggcggttattcagttggctacgactcgtacgat
ttgttcgacctcggtgagtttgatcaaaaaggctctgttgccactaagtatggtgataag
gcccaattgcttgaaaccatcgcggcgttaaaaagtaatgacattgcggtgctgctggac
gtggtggtgaaccacaaaatgggtgcggatgaaaaagagcccatccgtgtgcagcgcgtt
aatgagcaggaccggacccagatcgacgatgaagtcatcgaatgcgaagcctggacccgc
tacaccttccctgtccgcgccggtcaatattctcagtttgtctgggatttcaaatgcttt
agcggcattgatcatatcgaaaacccgaacgaggacagcatctttaaaatcgtcaatgat
tacaccggcgaaggctggaacgatcaggtcgataatgagttggggaatttcgactatttg
atgggcgaaaacattgattttcgcaatcatgccgtgacggaagagatcaaatactgggca
cgttgggtcatggaacagacccagtgcgacggttttcgactcgatgcagtcaaacatatc
cccgcctggttctacaaagagtggatcgaacacgtccaggaagtcgcgccaaaaccgctg
tttatcgtggcagaatactggtcccacgaagtcgacaaattgcagcaatacattgagcag
gtcgaaggcaaaaccatgctgttcgacgccccgctgcaaatgaaattccatgaagcgtct
cgccagggacgtgactatgacatgagccagattttcaccggtacgctggttgaagccgat
ccgttccacgcagtgacgctggtggccaaccatgacacccaaccccttcaggcgttagag
gccccggtcgaatcctggttcaaacccctcgcctacgcattaatcctgctgcgcgaaaac
ggcgtacccagcgtgttttaccccgatctctttggcgcgagctatgaagacacgggcggc
gacggcgaaacttaccctatcgaaatgccgattatcgaacagctgcacgagctgatcctc
gcccgtcaacgctttgcccatggggtacaaacgctctattttgatcatccaaactgtatt
gcgttcagccgcagcggcacggatgaagagccaggctgtgtggtagtgttgtctaacggt
gatgagggcgaaaaagtgatctgtctgggcgagaattacggcaacaagagctggcgtgat
ttcctcggcaaccgtgaagagacggtaactaccgccgcagatggcgaaggcacgttcacc
tgtaacggcggcagcgtgagtatctgggtgatggaggatgtactgtaa

DBGET integrated database retrieval system