KEGG   Enterobacter sp. 638: Ent638_2739Help
Entry
Ent638_2739       CDS       T00507                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ent  Enterobacter sp. 638
Pathway
ent00010  Glycolysis / Gluconeogenesis
ent00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ent00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ent638_2739
   00500 Starch and sucrose metabolism
    Ent638_2739
Enzymes [BR:ent01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Ent638_2739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase DUF4038
Motif
Other DBs
NCBI-ProteinID: ABP61404
UniProt: A4WCH4
LinkDB All DBs
Position
complement(2957141..2958538)
Genome map
AA seq 465 aa AA seqDB search
MKTFPETFLWGGAVAANQVEGAYLEEGKGLSTSDVQPQGVFGKVVERVEGDSGIKDVAID
FYHRYPDDIKLFAEMGFSCLRVSIAWTRIFPNGDEQQPNEAGLAFYDKLFDELAAHNITP
LVTLSHYEMPWGLVKQYGGWGSRQTIGFFERYARTVFARYKEKVKLWLTFNEINMSLHAP
MTGVGLPETSSKADVYQAIHHQLVASALAVKACHEIIPDAKIGNMLLGGLVYPLTCKPED
VLEALQENRAWQFFGDVQCRGAYPGYMLRFFRDNGITLEITDADREALKATVDFISFSYY
MTGCVTTDEELNQQARGNILSMVPNPHLASSEWGWQIDPLGLRTLLNVLWDRYQKPLFIV
ENGLGAKDKPDADGVVQDDYRIRYLNDHLVQVREAIDDGVDVMGYTSWGPIDLVSASKAE
LSKRYGFIYVDRDDSGNGTLARSRKKSFYWYQEVIATNGASLKAQ
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactttcccggaaacatttttgtggggcggcgcggttgccgcaaaccaggtagaa
ggcgcttatctggaggagggtaaaggcctgtcgacttctgacgtacagccgcagggggta
tttggcaaggtggtcgagcgcgtggagggcgacagcggcattaaagatgtggcgattgat
ttctatcatcgctacccggatgacatcaaactgtttgccgaaatgggctttagctgcctg
cgcgtgtcgatcgcctggacacgtatcttcccgaacggtgacgagcagcagccgaacgaa
gctgggctggcattttacgacaagctgtttgacgagctggcggcgcacaacatcacgccg
ctggtgacgctgtcgcattatgaaatgccgtggggactggtgaagcaatacggcggctgg
ggcagtcgtcagacgatcggcttctttgagcgttacgcgcgtaccgtatttgcgcggtac
aaagagaaagtgaagctgtggctcacgttcaatgaaatcaatatgtccctgcatgcgccg
atgaccggcgtcggcctgccggaaaccagtagcaaagcggacgtttatcaagcaattcac
catcagctggtggcgagtgcgctggcggtgaaggcctgccatgagattatcccggatgcc
aaaatcggcaacatgctgctcggcggcctggtttaccctctgacctgtaagccagaagat
gtgctggaagccttacaggaaaaccgcgcgtggcagttctttggcgacgtacagtgccgc
ggagcgtacccgggctatatgctgcgattcttccgcgataatgggattacgcttgaaatc
accgatgccgatcgcgaagcgctgaaagcaacagtcgattttatctccttcagctactac
atgaccggctgtgtgaccaccgacgaggaactcaaccagcaggcgcgcggcaatattctg
agcatggtgccgaacccgcatctggcgagctccgaatggggctggcaaattgaccccctt
ggcctgcgtacgctgctgaacgtgctgtgggatcgttatcagaagccgctgtttatcgtt
gaaaacggtttgggtgcgaaggataagccggacgctgacggcgtggtacaggacgactat
cgcattcgctatctcaacgaccatctggtgcaggtgcgcgaggcgatcgacgacggagtg
gacgtgatgggctacaccagttggggaccgatcgatctggtgagcgcatcgaaagctgag
ctatctaagcgttatggttttatctatgtcgatcgcgatgacagcggcaacggtacgctg
gcgcgcagccgtaagaaaagtttctactggtatcaagaagtgattgcaaccaacggggcg
tcgctgaaagcccagtaa

DBGET integrated database retrieval system