KEGG   Enterobacter sp. 638: Ent638_2851Help
Entry
Ent638_2851       CDS       T00507                                 

Definition
(GenBank) Glutathione S-transferase, N-terminal domain
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
ent  Enterobacter sp. 638
Brite
KEGG Orthology (KO) [BR:ent00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Ent638_2851
Enzymes [BR:ent01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     Ent638_2851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_N_3 GST_N_2 GST_C_3 GST_C_2 Cyc-maltodext_C
Motif
Other DBs
NCBI-ProteinID: ABP61516
UniProt: A4WCT6
LinkDB All DBs
Position
3090062..3090685
Genome map
AA seq 207 aa AA seqDB search
MIDLYYAPTPNGHKITLFLEETQIDYRIIKVDISKGDQFRPDFLTISPNNKIPAIVDTEP
ADGGRPFSLFESGEILLYLAEKSGKLLSDELRERHHTLQWLFWQSSGLGPMLGQNHHFNH
FAPQTIPYAIERYQFETQRLYTVMNKRLETSPWLGGEHYSIADIACWPWINAHERQRINL
ANYPAVNNWFERIRHRPATERAMQKMQ
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgatagacctctattacgccccaaccccaaacggtcataaaatcacgctttttctggaa
gaaacacagatagattaccgcatcattaaagtggatatcagcaagggcgatcagttcagg
cccgactttctgaccatctcccccaataacaaaattccggccatcgtcgataccgaaccg
gcagatggcggaagaccattcagtttgtttgaatcgggcgaaatcttgctgtatctggct
gaaaaatcaggaaaactgttgagtgatgaactgcgtgagcgccaccacacgctgcagtgg
ctcttctggcagtcaagcgggcttgggccgatgctcgggcaaaatcatcattttaatcat
ttcgccccgcaaaccatcccctatgccattgaacgttatcagtttgaaactcaacggctt
tacaccgtgatgaacaaacggctggagacgtcgccgtggttgggcggagaacattacagc
attgctgatattgcctgctggccgtggatcaacgcgcatgagcgccagcgaattaatctg
gccaattaccctgcggtgaataactggttcgagcgaatccgtcaccgccccgcgaccgaa
cgtgccatgcagaaaatgcagtaa

DBGET integrated database retrieval system