KEGG   Enterobacter sp. 638: Ent638_4030Help
Entry
Ent638_4030       CDS       T00507                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ent  Enterobacter sp. 638
Pathway
ent00620  Pyruvate metabolism
ent00680  Methane metabolism
ent01100  Metabolic pathways
ent01120  Microbial metabolism in diverse environments
ent01200  Carbon metabolism
Module
ent_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ent638_4030
  Energy metabolism
   00680 Methane metabolism
    Ent638_4030
Enzymes [BR:ent01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Ent638_4030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ABP62685
UniProt: A4WG55
LinkDB All DBs
Position
4378795..4381446
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKVLGDTIKDALGETILDRVETIRKLSKSSRAGNEANRQELLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISPKGEGASNPEVIARTLRKLKDQPELNEE
TIKKAVESLSLELVLTAHPTEITRRTLIHKMGEVNSCLKQLDNKDIVDYERNQLMRRLRQ
LIAQSWHTDEIRKYRPSPVDEAKWGFAVVENSLWEGVPNYLRELNEQLEENLGYRLPVDF
VPVRFTSWMGGDRDGNPNVTAEITRHVLLLSRWKATDLFLKDIQILISELSMVEATPELL
ELVGEAGATEPYRFLLKGLRGQLMATQAWLEARLKGQRLPKPAGLLSQNEQLWDPLYACY
KSLQACGMGIIANGELLDTLRRVKCFGVPLVRIDVRQESTRHTEALGELTRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRSWEPSEETSEVLNTCKAIVDAPKGSVAAYVISMAKTP
SDVLAVHLLLKEAGISFALPVAPLFETLDDLNNANDVMTQLLNIDWYRGFIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTISSLSLYTSAILEANLLPPPEPKDAWRHIMDEL
SDISCDLYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQKVVEDGKQTELETMCRDWPFFSTRLGMLEMVFSKVDLWLAE
YYDQRLVKPELWALGKELRELLEGDIKIVLAIANDSHLMADLPWIAESIQLRNIYTDPLN
VLQAELLHRSRKAEEEGKEADPRVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcgttgcgtagtaatgtcagtatgctcggcaaagtgctggga
gataccatcaaggatgcgctaggagagaccattctcgaccgcgtcgaaacaatccgtaag
ctgtccaaatcatcccgtgcaggaaatgaagccaatcgtcaggagctgctcaccacgctg
caaaacctgtcaaatgatgagcttctgcccgtggcgcgcgcgttcagccagttcctgaat
ctggctaacaccgccgagcaataccacagcatttcgccaaaaggcgaaggtgccagcaac
ccggaagtgattgcccgtacgctcagaaaactcaaagaccagcctgaactgaacgaagag
accatcaaaaaagcggttgagtccctttcgcttgagctggtgctgactgcgcacccgacc
gaaatcacccgccgtaccctgattcacaaaatgggcgaagtgaatagctgtctcaagcag
ttagataacaaagacatcgtcgattacgaacgtaaccagctgatgcgccgcctgcgccag
ctgattgctcagtcctggcacaccgatgaaattcgcaaatatcgcccaagcccggttgat
gaagctaaatggggttttgcggttgtcgaaaacagcctgtgggaaggcgtgccgaactac
ctgcgtgaattgaacgaacagctggaagagaacctcggctatcgcctgccggtggatttt
gttccggtgcgtttcacctcctggatgggtggcgaccgcgacggcaacccaaatgtgacc
gccgaaatcacgcgtcatgtgctattgctcagccgctggaaagccaccgatctgttcctg
aaagatattcagattctgatttctgagctgtcgatggtggaagccacgccagaattgctc
gaactggtcggcgaagccggtgcaaccgaaccgtaccgcttcttgctaaaaggtctgcgc
ggccagctgatggcgactcaagcctggctggaagcacgtttgaaaggccagcgtctgcca
aaaccagccgggctgctgagtcaaaacgagcagctgtgggacccgttgtacgcctgctat
aaatcactgcaagcgtgcggcatgggcatcatcgccaacggcgaactgctcgacaccctg
cgccgcgtgaagtgtttcggcgtgcctttggtgcgtattgatgtgcgtcaggaaagcacc
cgccataccgaagcgctgggcgagttgacccgctatctcggcattggcgattacgaaagc
tggtcagaagccgacaaacaggcgttcctgatccgcgaattaaattccaaacgtccgctt
ctgccacgcagctgggaaccaagcgaagaaaccagcgaagttctcaacacctgtaaagcg
atcgtcgatgcgccaaaaggatcggttgcggcctatgtgatctccatggccaaaacgccg
tctgacgtgctggccgttcatctgcttctgaaagaagccggtatcagctttgcgctgcct
gtcgcgccgctgtttgaaaccctcgacgacctgaataacgccaacgacgtgatgacccag
ttgctgaacatcgactggtatcgcggctttattcagggcaaacagatggtgatgattggc
tattccgactccgcaaaagacgcgggcgtgatggcggcatcctgggcgcagtaccaggcg
caagatgcgctgatcaaaacctgcgaaaaagcaggtatcgaattaacgctgttccacgga
cgcggcggctctatcggtcgcggcggtgcgccagctcatgctgcactgctctctcaacca
ccgggcagcctgaaaggcggtttgcgcgtcaccgagcaaggcgagatgatccgctttaaa
tacggtctgccagaagtaacaatcagtagcctgtcgctctacaccagcgcgattctggaa
gctaacctgttgccaccgccagagccgaaagacgcatggcgtcacatcatggatgagctg
tcggatatctcctgcgacttgtaccgtggctacgtgcgtgaaaacaaagacttcgtgccg
tacttccgctcggctacgcctgagcaggagctaggcaaactgccgctgggttctcgtccg
gcaaaacgccgtccgaccggcggtgtggaatctctgcgtgcgattccatggatcttcgcc
tggacgcaaaaccgcctgatgctgcccgcctggctgggtgcgggtgcggcgctgcaaaaa
gtggtggaagacggtaagcagactgagcttgagacaatgtgccgcgactggccgttcttc
tccacgcgccttggcatgctggaaatggtgttctccaaagtcgacctgtggctggcggaa
tactacgatcagcgtctggtgaaacccgaactgtgggcgttgggcaaagagctgcgcgaa
ctgctggaaggcgacattaaaattgtgctggctatcgccaacgactcgcatctgatggcc
gatttgccatggattgccgagtctattcagctgcgtaatatctacaccgacccgctgaac
gttctgcaggctgagctgttgcatcgctcacgtaaggccgaagaagaaggtaaagaggcg
gatccacgcgttgaacaggcgctgatggtgacgattgcgggcgttgcagcaggcatgcgt
aacaccggctaa

DBGET integrated database retrieval system