KEGG   Enterobacter sp. 638: Ent638_4063Help
Entry
Ent638_4063       CDS       T00507                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ent  Enterobacter sp. 638
Brite
Enzymes [BR:ent01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Ent638_4063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF4600
Motif
Other DBs
NCBI-ProteinID: ABP62718
UniProt: A4WG88
LinkDB All DBs
Position
complement(4417516..4418136)
Genome map
AA seq 206 aa AA seqDB search
MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQAYVNNANAALESLPEFAELSVEELITK
LDQLPADKKTVLRNNAGGHANHSLFWKGLKTGTTLQGDLKAAIERDFGSVDAFKAEFEKA
AATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAVSGVSGFPIVGLDVWEHAYYLKFQN
RRPDYIKAFWDVVNWDEAAARFAAKK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagttatacactgccatccctgccgtatgcctatgacgcactggaaccgcatttcgac
aagcagacgatggaaatccatcacactaaacaccaccaggcttatgtaaacaacgcgaac
gctgcgctggaaagcctgccagaattcgctgaactgtccgttgaagagctgatcaccaaa
ctggatcaactgccagcagacaagaaaaccgttctgcgtaacaacgctggcggtcacgct
aaccacagcctgttctggaaaggcctgaaaaccggcaccaccctgcagggcgacctgaaa
gcggctatcgagcgcgatttcggttctgtggatgctttcaaagcggaattcgagaaagcc
gctgcgacccgtttcggttctggctgggcttggctggttctgaaaggcgacaaactggct
gtggtttctaccgctaaccaggattccccgctgatgggtgaagccgtttctggcgtgtct
ggtttcccaatcgtgggcctggacgtgtgggaacacgcttactacctgaaattccagaac
cgtcgtccagactacatcaaagcattctgggacgtggtgaactgggacgaagcagccgcg
cgtttcgctgctaaaaaataa

DBGET integrated database retrieval system