KEGG   Enterobacter sp. E20: NI40_004390Help
Entry
NI40_004390       CDS       T04118                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
enx  Enterobacter sp. E20
Pathway
enx00730  Thiamine metabolism
enx00790  Folate biosynthesis
enx01100  Metabolic pathways
enx02020  Two-component system
Module
enx_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:enx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    NI40_004390
   00790 Folate biosynthesis
    NI40_004390
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NI40_004390
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:enx04147]
    NI40_004390
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:enx00537]
    NI40_004390
Enzymes [BR:enx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     NI40_004390
Exosome [BR:enx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NI40_004390
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:enx00537]
 Enzymes
  NI40_004390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Phosphodiest Sulfatase PT-VENN
Motif
Other DBs
NCBI-ProteinID: ALL16416
LinkDB All DBs
Position
947072..948487
Genome map
AA seq 471 aa AA seqDB search
MKQSALFIALLPLLITPAVYADTAQTSVLDNRAAKGDITQPGGARRLSEDQTAAIRASLN
DKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYALDKKTGKPDY
VTDSAASATAWSTGVKTYNGALGVDIHEKDHQTLLEMAKAAGLATGNVSTAELQDATPAA
LVAHVTSRKCYGPSVTSEKCPTNALEKGGKGSITEQLLNARPDVTLGGGAKTFAETATAG
EWQGKTLREQAQARGYQLVSDANSLAAITEANQDKPLLGLFSDGNMPVRWEGPKASYHGN
IDKPAVTCTPNPKRTDSVPTLAAMTDKAISLLSKSEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQKALEFAKKDGNTLVIVTADHAHASQIIPPDTKAPGLTQALNTKDGAVM
VLSYGNSEEESMEHTGTQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGFK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacagagcgcacttttcatcgcattacttcccctgttaattacccctgccgtttat
gccgatactgcccaaaccagcgtgctggataatcgcgcggcaaaaggggatatcacccag
cctggcggcgcacgccgtttatcagaagatcaaactgccgctattcgcgcttcgctgaat
gataagccagcgaaaaatattattctgcttattggcgatggaatgggggattccgaaatc
acggcggcgcgaaattatgccgagggtgcgggcggcttttttaaaggcatcgacgcatta
ccgctgaccggacaatatacccattacgcgctggataaaaaaaccggtaaaccggattac
gtcacggactccgcggcctctgctacggcgtggtccaccggcgtgaaaacctataatggc
gcgctgggtgtggatattcacgaaaaagatcatcaaacccttctggagatggcaaaagcg
gcgggcctggcgaccggcaacgtctccaccgctgaacttcaggatgcaacgcccgcggcg
ctggtggcgcacgtgacctcgcgtaaatgctacggtccgtcagtgaccagcgaaaaatgc
ccgacgaacgcgctggaaaaaggcggcaaaggctcgattacggaacagctgctgaacgcg
cgtcctgacgtgaccctcggcggcggcgcgaaaaccttcgcagaaaccgcaacggcaggc
gagtggcagggcaaaacgctgcgcgagcaggcgcaggcccgcggctatcagctggtgagt
gatgcaaattcgctggcagccatcaccgaggcgaaccaggacaagccgctgctggggcta
ttctctgacggcaacatgcccgtgcgctgggaaggaccaaaagcctcttatcacggcaat
atcgataaacctgccgtgacctgtacgcctaacccgaaacgcacggacagcgtaccgacg
ctggcggcgatgaccgataaagccatctctctgctgagcaagagcgaaaaagggttcttc
ctgcaggttgagggcgcgtcgatcgataagcaggatcatgcggcgaatccgtgcggccag
attggcgaaaccgtcgatctggacgaagcggtgcagaaggcgcttgagttcgcgaaaaaa
gacggcaacaccctggtgatcgtcaccgcggaccatgcccatgccagccagatcatcccg
ccagataccaaagccccgggcctgacgcaggcgctgaataccaaggatggtgccgttatg
gtgttgagctacggcaactctgaggaagagtccatggagcacaccggcacccagctgcgc
attgcagcctacggcccgcacgcggcaaacgtggtaggcttgaccgatcaaacggatctg
ttctacaccatgaaggcggcgctgggttttaaatga

DBGET integrated database retrieval system