KEGG   Enterobacter sp. E20: NI40_005650Help
Entry
NI40_005650       CDS       T04118                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
enx  Enterobacter sp. E20
Brite
KEGG Orthology (KO) [BR:enx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NI40_005650
Enzymes [BR:enx01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     NI40_005650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored NAD_binding_8 HI0933_like FAD_binding_3 Thi4 Glutaredoxin K_oxygenase DAO AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ALL16661
LinkDB All DBs
Position
1224143..1225708
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSPKVTFKEDNALPV
RKPSFLITNPGSDQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQALLEQIRDIDGDFE
FETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEITDRNVMGVPAVYMNGKE
FGQGRMTLTEIVAKVDTGAEKRAAEELNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYDVDVIDSQSASKLVPAAVEG
GLHQIETASGAVLKARSIIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKCVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIVLNAQTTEVKGD
GSKVTGLEYRDRVSGDVHSVQLSGIFVQIGLLPNTTWLEGAIERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSSFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacactaacatgaaaacccagctcaaggcctaccttgagaaactgaccaaaccc
gttgagctgattgccacgctggacgacagcgccaaatcggcagaaatcaaggaactgctg
gcggagatcgccgagctgtcgccgaaagtgaccttcaaagaagacaacgcgctgccggtc
cgtaagccctctttcctgattaccaacccaggctccgaccagggaccgcgctttgccggc
tcgccgctgggtcacgaatttacctcactggtgctggcgctgctgtggaccggtggtcat
ccgtcaaaagaagcgcaggcgctgctggagcagatccgcgatatcgacggtgatttcgaa
tttgaaacctattactcgctctcctgccacaactgcccggacgtggtgcaggcgctgaac
ctgatgtcggttctgaacccgcgcatcaagcacacggcgattgacggcggtaccttccag
aatgaaatcaccgatcgcaacgtgatgggcgttccggcggtctatatgaacggcaaagag
ttcggccagggccgcatgacgctgactgaaatcgttgccaaagtggataccggtgctgaa
aaacgtgcggcggaagagctgaacaaacgcgatgcctacgacgtgctgatcgtcggttcc
ggccctgcgggcgcggcggcagcggtgtactctgcgcgtaaaggtattcgtaccggcctg
atgggcgaacgttttggcggccaggtgctcgataccgtggacatcgaaaactacatctcc
gtgccgaagaccgaaggccagaagctggcgggggcgctgaaggcgcacgtcagcgactac
gacgtggacgtgattgacagccagagcgccagcaagctggttccggcagcggtcgagggt
ggtttacaccagattgaaaccgcgtccggcgcggtgctgaaagcgcgcagcattatcatt
gccaccggcgcgaaatggcgcaacatgaacgttccgggcgaagatcaataccgtaccaaa
ggcgtgacctactgtccgcactgcgacggcccgctgtttaaaggtaaatgcgtggcggtg
atcggcggcggtaactccggcgtggaagcggctatcgacctggcggggattgttgagcac
gttacccttctggagttcgctccagagatgaaggccgaccaggttctgcaggataaagtt
cgcagcctgaaaaacgtcgacatcgtactgaacgcgcagaccacggaagtgaagggcgac
ggcagcaaagtgaccggcctggaataccgcgaccgcgtgagcggcgacgtgcacagcgtt
cagctgtcagggatcttcgtgcagattggtctgctgccaaataccacctggctggaaggc
gcgattgagcgcaaccgcatgggcgaaatcatcatcgatgcgaaatgtgaaaccagcgtg
aaaggcgtgtttgcggcgggcgactgcaccaccgtgccgtataaacagatcattatcgcc
acgggcgaaggggcgaaggcgtctctgagttcctttgactacctgattcgcaccaaaacc
gcataa

DBGET integrated database retrieval system