KEGG   Enterobacter sp. E20: NI40_006040Help
Entry
NI40_006040       CDS       T04118                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
enx  Enterobacter sp. E20
Pathway
enx00020  Citrate cycle (TCA cycle)
enx00190  Oxidative phosphorylation
enx00650  Butanoate metabolism
enx01100  Metabolic pathways
enx01110  Biosynthesis of secondary metabolites
enx01120  Microbial metabolism in diverse environments
enx01130  Biosynthesis of antibiotics
enx01200  Carbon metabolism
Module
enx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
enx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
enx_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:enx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NI40_006040 (sdhA)
   00650 Butanoate metabolism
    NI40_006040 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NI40_006040 (sdhA)
Enzymes [BR:enx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NI40_006040 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     NI40_006040 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like DAO Thi4
Motif
Other DBs
NCBI-ProteinID: ALL16730
LinkDB All DBs
Position
1301758..1303524
Genome map
AA seq 588 aa AA seqDB search
MKLPVREFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSHTVSAQGGITVALGNS
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELDHMGLPFSRLENGTIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNADGAIVGC
TALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDGVGMAIRAGVPVQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTKVTGQALTVNEQGEDVVIPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAVGLHLQ
ESIAEQGALRDATDDEIDASLERLNRWNGNRNGEDPVEIRKALQECMQHNFSVFREGDAM
AKGLEQLKAIRERLKNARLDDTSSEFNTQRVECLELDNLMETAFATAMSANFRTESRGAH
SRFDFPDRDDENWLCHSLYLPESESMTRRSVNMEPKLRPAFPPKIRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgccagtcagagaatttgatgctgttgtaattggtgccggtggcgcaggtatg
cgtgccgcactgcaaatttcccagagcggccagacctgtgcgctgctctctaaagttttc
ccgacccgttcccacactgtgtctgcgcagggcggtatcaccgttgcgctgggcaactcc
catgaagataactgggaatggcacatgtacgacacggtaaaaggttccgactacatcggc
gaccaggatgccatcgaatatatgtgtaaaaccggcccggaagcgattctggagctggac
cacatgggtctgccgttctcccgtctggaaaatggcaccatctatcagcgtccgtttggc
ggccagtcgaaaaacttcggcggcgagcaggcggcacgtaccgcggcggcggctgaccgt
accggtcacgcactgctgcacaccctgtatcagcagaacctgaaaaaccataccaccatc
ttctccgagtggtacgcgctggatctggtgaaaaacgccgatggcgcaatcgtcggctgt
accgcgctgtgcatcgaaaccggtgaagtggtttacttcaaagcccgcgctaccgtgctg
gctaccggcggcgcaggccgtatctatcagtccaccaccaacgcccacatcaacaccggt
gacggtgtcggtatggctatccgcgcgggcgtgccggtgcaggatatggagatgtggcag
ttccacccaaccggtatcgccggtgcgggcgttctggtaacagaaggctgccgcggtgaa
ggtggttacctgctgaacaagcacggcgagcgcttcatggagcgttatgccccgaatgcg
aaagacctggcgggtcgtgacgtggtggcgcgttccatcatgatcgaaatccgtgaaggc
cgcggctgtgacggcccatggggtccacacgcgaagctgaagctcgaccacctgggtaaa
gaagttctggagtcccgtctgccgggcatcctggagctgtcccgcaccttcgcacacgtc
gacccggtgaaagagccgattccggttatcccaacctgccactacatgatgggcggtatt
ccgaccaaagtgaccggtcaggcgctgaccgtaaacgagcagggcgaagacgtggttatt
cctggcctgttcgcggtaggcgaaattgcctgcgtatccgtacacggtgcaaaccgtctg
ggcggcaactccctgctggatctggtggtgtttggtcgtgcagtcggtctgcatctgcag
gaatccattgccgagcagggcgcgctgcgtgacgcaaccgacgacgaaattgatgcctct
cttgagcgcctcaaccgctggaacggtaaccgtaacggcgaagatccggtggaaatccgt
aaagcgctgcaggaatgcatgcagcacaacttctcggtattccgcgaaggcgacgcgatg
gccaaaggtcttgagcagctgaaagcgatccgcgagcgtctgaaaaatgcccgtctggac
gacacctccagcgaattcaacacccagcgcgttgagtgcctggagctggataacctgatg
gaaaccgcgttcgcgacggcgatgtcggcaaacttccgtaccgaaagccgtggcgcgcat
agccgcttcgacttcccggatcgtgatgacgaaaactggctgtgccattccctgtatctg
ccagagtcggaatccatgacgcgtcgtagcgtcaatatggaaccgaaactgcgtccggcg
ttcccgccgaagattcgtacttactaa

DBGET integrated database retrieval system