KEGG   Enterobacter sp. E20: NI40_006045Help
Entry
NI40_006045       CDS       T04118                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
enx  Enterobacter sp. E20
Pathway
enx00020  Citrate cycle (TCA cycle)
enx00190  Oxidative phosphorylation
enx00650  Butanoate metabolism
enx01100  Metabolic pathways
enx01110  Biosynthesis of secondary metabolites
enx01120  Microbial metabolism in diverse environments
enx01130  Biosynthesis of antibiotics
enx01200  Carbon metabolism
Module
enx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
enx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
enx_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:enx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NI40_006045 (sdhB)
   00650 Butanoate metabolism
    NI40_006045 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NI40_006045 (sdhB)
Enzymes [BR:enx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NI40_006045 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     NI40_006045 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_18 Fer4_9 Fer4
Motif
Other DBs
NCBI-ProteinID: ALL16731
LinkDB All DBs
Position
1303540..1304256
Genome map
AA seq 238 aa AA seqDB search
MKLEFSVYRYNPDVDDAPRMQDYTLEAEEGRDMMLLDALIQLKEKDPTLSFRRSCREGVC
GSDGVNMNGKNGLACITPISALQRPGQKIVIRPLPGLPVVRDLVVDMGQFYAQYEKIKPY
LLNNGQNPPAREHLQSPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
FLIDSRDTETDSRLEGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRSA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgaattctcagtttatcgttataacccggatgttgatgatgctccgcgtatg
caggactacaccctggaagcggaagaaggtcgcgacatgatgctgctggatgcgttaatc
cagctgaaagaaaaagatcctacgctgtcgttccgccgctcctgccgtgaaggggtttgt
ggctctgacggtgtgaacatgaacggcaaaaatggcctggcctgcatcacgccaatttca
gcgctgcagcgtcctggtcagaaaattgttatccgtcctctgccaggcctgccggtcgtg
cgtgatttggtggtagacatggggcaattctatgcacaatatgagaagattaagccttac
ttattgaataatgggcaaaatccacccgctcgcgagcacttacagtctcctgagcagcgt
gaaaaactcgatgggttgtacgagtgtattctctgcgcatgctgttcaacgtcctgcccg
tcgttctggtggaacccggacaagtttatcggcccggccggtctgctggctgcctatcgc
ttcctgatcgatagccgcgacaccgaaaccgacagccgtctggaagggctgagtgacgct
ttcagcgtattccgctgccatagcatcatgaactgcgtcagtgtgtgtccgaaggggctg
aacccgacgcgcgccatcggccatattaagtcgatgctgctgcagcgcagtgcgtaa

DBGET integrated database retrieval system