KEGG   Enterobacter sp. E20: NI40_014065Help
Entry
NI40_014065       CDS       T04118                                 

Definition
(GenBank) cytoplasmic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
enx  Enterobacter sp. E20
Pathway
enx00500  Starch and sucrose metabolism
enx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:enx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NI40_014065
Enzymes [BR:enx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     NI40_014065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C DUF1939 CdhD
Motif
Other DBs
NCBI-ProteinID: ALL19836
LinkDB All DBs
Position
3007899..3009386
Genome map
AA seq 495 aa AA seqDB search
MKNPTLLQCFHWYYPAGGELWREVTALAPNLNEIGINMIWLPPACKGASGGYSVGYDTYD
LFDLGEFDQKGSIATKYGDKAQLLEAIDALKSNDIAVLLDVVVNHKMGADEKEPVRVQRV
NEQDRTQIDDEVIECEAWTRYTFPARAGQYSQFIWDYKCFSGVDHIENPDEDGIFKIVND
YTGEGWNDQVDDEMGNFDYLMGENIDFRNHAVTEEIKYWARWVMEQTRCDGFRLDAVKHI
PAWFYKEWIEHVQEVADQPLFIVAEYWSHEVDKLQAYIDQVEGKTMLFDAPLQMKFHEAS
RQGRDYDMSQIFTGTLVEADPFHAVTLVANHDTQPLQALEAPVEAWFKPLAYALILLREN
GVPSVFYPDLFGASYDDAGGDGETYHIDMPVIEQLHELILARQRFAHGVQTLFFDHPNCI
AFSRSGTEDDPGCVVVMSNGDDGEKVICLGENYGNKTWRDFLGNREETITTAADGEGTFT
CNGGSVSVWVIEDAL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccccaccctgttacaatgttttcactggtactaccctgctggcggtgaattg
tggcgtgaggtcacggcgttagctcccaatcttaacgaaatcggcatcaacatgatctgg
ctgccgcccgcctgtaaaggggcatccggcgggtattctgtcggctatgacacctatgac
ctgttcgatcttggcgagtttgaccagaaaggcagtatcgccacgaaatacggcgacaag
gcgcagctgctggaggctattgatgcccttaaaagcaacgacattgccgttctgctggac
gtggtggtcaaccacaaaatgggcgccgatgaaaaagagcccgtgcgcgttcagcgcgtg
aacgaacaggaccgcacgcaaatcgatgacgaggtcattgaatgcgaagcctggactcgc
tacaccttcccagcccgggccgggcagtactcacagtttatctgggactacaaatgcttc
agcggcgtcgaccacattgaaaaccccgatgaagacggcatctttaaaatcgtcaacgac
tataccggcgaaggctggaacgatcaggttgatgatgagatgggcaacttcgattacctg
atgggcgaaaatatcgactttcgcaatcacgccgtgaccgaggagatcaaatactgggcc
cgctgggtcatggaacagacgcgctgcgacggttttcgtctggacgccgtcaagcatatt
cccgcctggttttacaaggagtggattgagcacgtccaggaagtcgccgaccagccgctg
tttatcgtggcggaatactggtcccatgaagtggataaacttcaggcctatatcgaccag
gtcgaaggcaaaaccatgctgtttgatgcccctctgcagatgaaattccacgaggcgtca
cgtcagggccgggattacgacatgagccaaatcttcaccggtaccctggtggaagccgat
ccgttccatgcggtcaccctcgtcgcgaaccatgacacccagcctttgcaggcgcttgaa
gcaccggtcgaagcctggtttaaaccgctggcgtacgcgctgatcctgctgcgggaaaat
ggcgtgccgagcgtcttttatccggatctcttcggcgccagctatgacgacgcgggaggc
gacggtgaaacgtaccatattgatatgccggtcattgagcagcttcacgagctgatcctc
gcgcgccagcgttttgcccacggcgtgcaaacgctgtttttcgaccatccaaactgcatc
gccttcagccgcagcggtactgaagacgatcccggctgcgtggtggtgatgtcgaacggg
gatgatggtgaaaaagtgatttgtcttggggaaaactacggcaacaaaacgtggcgggat
tttctcggcaatcgcgaagaaaccatcaccacggcggcggatggcgaagggacgtttacc
tgtaatgggggaagcgtcagcgtttgggtgatagaggatgcgttgtag

DBGET integrated database retrieval system