KEGG   Enterobacter sp. E20: NI40_015835Help
Entry
NI40_015835       CDS       T04118                                 

Gene name
fadJ
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
enx  Enterobacter sp. E20
Pathway
enx00071  Fatty acid degradation
enx00280  Valine, leucine and isoleucine degradation
enx00281  Geraniol degradation
enx00310  Lysine degradation
enx00362  Benzoate degradation
enx00380  Tryptophan metabolism
enx00410  beta-Alanine metabolism
enx00640  Propanoate metabolism
enx00650  Butanoate metabolism
enx00903  Limonene and pinene degradation
enx00930  Caprolactam degradation
enx01100  Metabolic pathways
enx01110  Biosynthesis of secondary metabolites
enx01120  Microbial metabolism in diverse environments
enx01130  Biosynthesis of antibiotics
enx01200  Carbon metabolism
enx01212  Fatty acid metabolism
Module
enx_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:enx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    NI40_015835 (fadJ)
   00650 Butanoate metabolism
    NI40_015835 (fadJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NI40_015835 (fadJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NI40_015835 (fadJ)
   00310 Lysine degradation
    NI40_015835 (fadJ)
   00380 Tryptophan metabolism
    NI40_015835 (fadJ)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NI40_015835 (fadJ)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    NI40_015835 (fadJ)
   00281 Geraniol degradation
    NI40_015835 (fadJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NI40_015835 (fadJ)
   00930 Caprolactam degradation
    NI40_015835 (fadJ)
Enzymes [BR:enx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     NI40_015835 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     NI40_015835 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     NI40_015835 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DUF362
Motif
Other DBs
NCBI-ProteinID: ALL18571
LinkDB All DBs
Position
complement(3403938..3406085)
Genome map
AA seq 715 aa AA seqDB search
MDMPSAFNLTVRLDNVAVITIDVPDEKMNTLKAEFGVQVRAMLKQIRDNKAIRGLVFISA
KPDNFIAGADINMIARAQSALEAEELARQGQQVMAEINGLPIPVIAAIHGACLGGGLELA
LACHSRICTDDAKTILGLPEVQLGLLPGSGGTQRLPRLVGVSTALEMILTGKQLRARQAM
KAGLVDDVVPQSILLEAAVELALKGRQAKRPLPVRERVLAGPLGRTLLFNMVGKKTEQKT
KGNYPAAKRILEVIETGLSQGSSSGYAAEAKAFGELAMTPQSQALRSIFFASTDVKKDPG
SEAQPAPLRAIGVLGGGLMGGGISFVTASKGKLPVRIKDINPKGINHALQYSWQNLDQKV
KRRHIKASERDKTLAMISGTTDYSGFAHRDLVIEAVFEDLALKQQMVADVEQHCAPHTIF
ASNTSSLPIGDIAGKAARPEQVIGLHFFSPVEKMPLVEVIPHATTSPQTVATVVKLAKKQ
GKTPIVVADKAGFYVNRILAPYINEAMRLLTEGEKIEHVDEALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLEAAYGDRFSPPANIVSAILKDDRKGRKNERGFYLYGAKGRKSRKQVDPS
VYGLISTTGQGKLSAVQCAERCVMMMLNEAARCFDEQVIKSARDGDIGAVFGIGFPPFLG
GPFRYMDTLGAGEVVAILQRLASQYGPRFTPCDQLLQMAERGQTFWPARETVLVS
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggatatgccatctgcatttaatctgacggttcgcctcgataacgtggccgttatcacg
atcgatgtgcctgatgaaaagatgaataccctgaaggccgaatttggtgttcaggtgcgc
gcgatgctaaagcagatccgcgacaacaaagcgattcgtggtctggtctttatctctgcc
aagccggataactttatcgccggcgcggatatcaacatgatcgcccgggcgcaaagcgct
ctggaagccgaagagctggcgcgtcagggccagcaggtcatggcggagatcaacggtctg
ccgatcccggtcattgccgcgatccacggtgcctgcctgggtggtgggcttgagctggcg
ctggcctgtcacagccggatttgcaccgacgatgcgaaaacgattctgggtctgccggaa
gtgcagctgggcctgctgcctggctccggcggaacgcaacgactgccgcgcctggtgggc
gtaagcacggcgctggagatgatcttaaccggtaaacagctgcgtgcccgtcaagcgatg
aaagccggtctggtcgatgacgtcgtgccgcagtccattttgctggaagccgccgttgag
cttgcgctgaaagggcgtcaggcaaaacgtcctctgccggtacgtgagcgcgtgctggcc
ggcccgctgggaagaacgctcctgttcaacatggtgggcaaaaagaccgaacaaaaaacc
aaaggcaattacccggcggcaaagcggatcctcgaagtgatcgagaccgggctgtcgcag
ggaagcagcagcggctatgccgcggaggccaaagcctttggcgaactggcgatgacgccg
cagtcgcaggcgctgcgcagcatcttcttcgccagcacggacgtgaaaaaagatccgggc
agcgaggcgcagcctgcgccgctgcgtgcgattggcgtactgggtggggggctcatgggt
ggcggaatctcttttgttaccgccagcaaaggcaaattgcctgtacgaatcaaagacatt
aatcctaaggggatcaatcacgcgctacagtacagctggcagaaccttgatcaaaaggtc
aagcgccgccatatcaaggcaagcgagcgcgacaaaaccctggcgatgatctccggtacg
acggattacagcggttttgcgcaccgcgatctggtgattgaagccgtgtttgaagatctg
gcgcttaagcagcagatggtggcagacgttgagcaacattgcgccccgcataccattttt
gcctccaatacgtcgtcattaccgattggcgatatcgcagggaaagccgcgcgcccggag
caggtgattgggctgcatttctttagcccggtcgaaaaaatgccgctggtggaagttatt
ccgcacgcgactaccagtccgcaaactgttgccaccgtggtgaagctggcgaaaaaacag
ggcaaaaccccgattgtggtagcggacaaagctggcttctacgtcaaccgcattctggct
ccttacattaatgaagcaatgcggttgctgacggaaggggagaagattgagcacgtcgac
gaggcgctggtaaagtttggtttccccgttggcccaatccaacttttggatgaggtggga
atagacaccggcactaaaattataccagtgctggaagctgcatatggcgatcgttttagc
ccacctgcaaacattgtttctgcgattttgaaggacgatcgcaaaggcagaaaaaatgaa
cgcggtttctatctttacggcgcgaaagggcgtaaaagcaggaaacaggtcgacccttcg
gtatatggactcatttcgaccacaggtcagggaaaactgtccgccgttcagtgcgctgag
cgctgcgtgatgatgatgctcaatgaagcggcgcgctgctttgatgagcaggtgatcaag
agtgcacgcgatggcgacatcggcgcggtatttggcattggtttcccgccgttccttggc
ggcccgttccgttacatggatacgctcggcgcgggtgaagtggttgctatcctgcaacgt
ctggcttcgcaatatggtccacggtttacaccgtgtgaccaattattgcagatggcggaa
cgcggccagacattttggcctgcaagggaaactgtcctcgtaagctga

DBGET integrated database retrieval system