KEGG   Escherichia coli O7 K1 CE10: CE10_1683Help
Entry
CE10_1683         CDS       T01999                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase B, PLP-dependent
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
eoc  Escherichia coli O7:K1 CE10
Pathway
eoc00250  Alanine, aspartate and glutamate metabolism
eoc00410  beta-Alanine metabolism
eoc00430  Taurine and hypotaurine metabolism
eoc00650  Butanoate metabolism
eoc01100  Metabolic pathways
eoc01110  Biosynthesis of secondary metabolites
eoc01120  Microbial metabolism in diverse environments
eoc02024  Quorum sensing
Module
eoc_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:eoc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CE10_1683 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CE10_1683 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CE10_1683 (gadB)
   00430 Taurine and hypotaurine metabolism
    CE10_1683 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CE10_1683 (gadB)
Enzymes [BR:eoc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CE10_1683 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AEQ12485
UniProt: A0A0E0V5W8
LinkDB All DBs
Structure
PDB: 

Position
complement(1717331..1718731)
Genome map
AA seq 466 aa AA seqDB search
MDKKQVTDLRSELLDSRFGAKSISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNL
ATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVG
TNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQICWHKFARYWDVELREI
PMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTGIDIDM
HIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEEALPQELV
FNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKL
GPYEFICTGRPDEGIPAVCFKLKDGEDPGYTLYDLSERLRLRGWQVPAFTLGGEATDIVV
MRIMCRRGFEMDFAELLLEDYKASLKYLSAHPKLQGIAQQNSFKHT
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggataagaagcaagtaacggatttaaggtcggaactactcgattcacgttttggtgca
aagtctatttccactatcgcagaatcaaaacgttttccgctgcacgaaatgcgcgacgat
gtcgcatttcagattatcaatgacgaattatatcttgatggcaacgctcgtcagaacctg
gccactttctgccagacctgggacgacgaaaatgtccacaagttgatggatttatccatt
aacaaaaactggatcgacaaagaagaatatccgcaatccgcagccatcgacctgcgttgc
gtaaacatggttgccgatctgtggcatgcgcctgcaccgaaaaatggtcaggccgttggc
accaacaccattggttcttccgaggcctgtatgcttggcgggatggcgatgaaatggcgt
tggcgcaagcgtatggaagctgcaggtaagccaacggataaaccaaacctggtgtgcggt
ccggtgcaaatctgctggcataaattcgcccgctactgggatgtggagctgcgtgagatc
cctatgcgccccggtcagttgtttatggacccgaaacgcatgattgaagcctgcgacgaa
aacaccatcggcgtggtgccgactttcggcgtgacctacaccggtaactatgagttcccg
cagccgctgcacgatgcgctggataaattccaggccgacaccggtatcgacatcgacatg
cacatcgacgccgccagcggtggcttcctggcaccgttcgtcgccccggatatcgtctgg
gacttccgcctgccgcgtgtgaaatcgatcagtgcttcaggccataaattcggtctggct
ccgctaggctgcggctgggttatctggcgtgatgaagaagcgctgccgcaggaactggtg
ttcaacgttgactatctcggtggtcagattgggactttcgccatcaacttctcccgcccg
gcgggtcaggtgattgcacagtactatgaattcctgcgcctcggtcgtgaaggctatacc
aaagtacagaacgcttcctaccaggttgccgcttatctggcggatgaaatcgccaaactg
gggccgtatgagttcatctgtaccggtcgcccggacgaaggcatcccggcggtttgcttc
aaactgaaagatggtgaagacccgggatacaccctgtatgacctctctgaacgtctgcgt
ctgcgcggctggcaggttccggccttcactctcggcggtgaagccactgacatcgtggtg
atgcgcattatgtgtcgtcgcggcttcgaaatggactttgctgaactgttgctggaagac
tacaaagcctccctgaaatatctcagcgctcacccgaaactgcagggtattgcccagcag
aacagctttaaacacacctga

DBGET integrated database retrieval system