KEGG   Escherichia coli O7 K1 CE10: CE10_2054Help
Entry
CE10_2054         CDS       T01999                                 

Gene name
ydjJ
Definition
(GenBank) putative oxidoreductase, Zn-dependent and NAD(P)-binding protein
Organism
eoc  Escherichia coli O7:K1 CE10
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 ADH_N_2 Cupin_2
Motif
Other DBs
NCBI-ProteinID: AEQ12841
UniProt: A0A0E0V5Z5
LinkDB All DBs
Structure
PDB: 

Position
complement(2076498..2077541)
Genome map
AA seq 347 aa AA seqDB search
MKNSKAILQVPGTMKIISAEIPVPKEDEVLIKVEYVGICGSDVHGFESGPFIPPKDPNQE
IGLGHECAGTVVAVGSRVRKFKAGDRVNIEPGVPCGHCRYCLEGKYNICPDVDFMATQPN
YRGALTHYLCHPESFTYKLPDNMDTMEGALVEPAAVGMHAAMLADVKPGKKIIILGAGCI
GLMTLQACKCLGATDIAVVDVLEKRLTMAEQLGATVVINGAKEDTIARCQQFTEEMGADI
VFETAGSAVTVKQAPYLVMRGGKIMIVGTVPGDSAINFLKINREVTIQTVFRYANRYPVT
IEAISSGRFDVKSMVTHIYDYQDVQQAFEESVNNKRDIIKGVIKISD
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattcaaaagcaatattgcaggtgccgggcacaatgaaaattatttcagcagaa
atacctgtgcctaaagaagatgaagttttgattaaagtagaatatgtcggtatttgtggt
tcagatgtacatggttttgaatcaggcccgtttattccgcctaaagacccaaatcaagaa
attggcctgggacatgaatgcgccgggacggttgtggctgtgggaagccgtgtgcgcaaa
tttaaagcgggggatcgggtaaatatcgaacctggcgttccttgcggtcactgtcgttac
tgtctggaaggcaaatataacatctgcccggacgttgattttatggcgacacaacctaac
taccgcggcgcattaacgcactatctgtgtcatccggagagctttacttacaaactgccc
gacaatatggacacgatggaaggggcgctggtggagcctgccgcagtcgggatgcatgcc
gcgatgctggcagatgttaaaccgggtaagaagataattattctgggagcgggttgtatt
ggtttgatgacgttgcaagcatgcaaatgcctgggagctacggatattgccgtcgttgat
gtactggaaaaacgtctgacaatggcggaacagctcggcgcgacagtggttattaacggc
gcaaaagaagacactattgcacgctgtcagcaatttaccgaagaaatgggcgcagatatt
gttttcgaaacagcgggttctgcggtcaccgttaaacaggcaccttatctggtaatgcgc
ggcggtaaaattatgattgttggtactgtaccgggcgattcggcaatcaatttcctcaaa
atcaatcgcgaagtcactatccagacagtattccgctatgccaatcgttatccggtcacg
attgaagctatttcctcagggcgattcgatgtgaaatcgatggtgacacatatttacgat
tatcaggatgtacaacaggcatttgaagagtcggttaacaacaaacgcgacattattaaa
ggcgttattaaaattagcgattaa

DBGET integrated database retrieval system