KEGG   Escherichia coli O7 K1 CE10: CE10_2327Help
Entry
CE10_2327         CDS       T01999                                 

Gene name
dacD
Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase (penicillin-binding protein 6b)
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
eoc  Escherichia coli O7:K1 CE10
Pathway
eoc00550  Peptidoglycan biosynthesis
eoc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eoc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CE10_2327 (dacD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:eoc01002]
    CE10_2327 (dacD)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eoc01011]
    CE10_2327 (dacD)
Enzymes [BR:eoc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CE10_2327 (dacD)
Peptidases and inhibitors [BR:eoc01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   CE10_2327 (dacD)
Peptidoglycan biosynthesis and degradation proteins [BR:eoc01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   CE10_2327 (dacD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: AEQ13102
UniProt: A0A0E0V6D3
LinkDB All DBs
Structure
PDB: 

Position
complement(2343800..2344966)
Genome map
AA seq 388 aa AA seqDB search
MKRRLTIAASLFVFNLSSGFAAENIPFSPQPPEIHAGSWVLMDYTTGQILTAGNEHQQRN
PASLTKLMTGYVVDRAIDSHRITPDDIVTVGRDAWAKDNPVFVGSSLMFLKEGDRVSVRD
LSRGLIVDSGNDACVALADYIAGGQRQFVEMMNNYAEKLHLKDTHFETVHGLDAPGQHSS
AYDLAVLSRAIIHGEPEFYHMYSEKSLTWNGITQQNRNGLLWDKTMNVDGLKTGHTSGAG
FNLIASAVDGQRRLIAVVMGADSAKGREEEARKLLRWGQQNFTTVQILHRGKKVGTERIW
YGDKENIALGTEQEFWMVLPKAEIPHIKAKYTLDGKELTAPISAHQRVGEIELYDRDKQV
AHWPLVTLESVGEGSMFSRLSDYFHHKA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacgccgtcttactattgctgcttctttgttcgtttttaatttatcgtctggtttt
gcggcggaaaacattcctttttcacctcagcctccagagattcatgccgggtcctgggta
ttgatggattacaccaccggtcagattctcaccgcgggtaatgagcatcaacagcgcaat
cccgccagcctgacaaagctgatgacgggctatgtcgtggatcgtgctatcgatagtcat
cgcattacgccagacgatattgtcaccgtggggcgcgatgcgtgggcgaaagataatccg
gtgtttgtcggttcttcactgatgtttctgaaagagggcgatcgcgtatcggtacgtgat
ttaagccgtggtttaattgtggattccggaaatgacgcttgtgttgctctggctgactat
attgccggtgggcaacggcagtttgttgaaatgatgaacaactatgccgagaagctgcat
ctcaaggatacgcattttgaaacagtgcatggtctggatgcacctggccagcatagctcg
gcttatgatttagctgtgctttctcgcgctatcatccacggcgagcccgagttttatcat
atgtacagtgagaaaagcctcacctggaacggtatcactcagcaaaaccgtaacgggtta
ttgtgggataaaaccatgaatgttgacggcctgaaaacgggtcatacttctggtgccggg
tttaatctcattgcttcggctgtggatgggcagcgtcgtctcattgcagtggtaatgggg
gctgacagtgcaaaaggtcgtgaggaagaggcaagaaaattactgcgttggggtcaacaa
aactttactacggtgcaaattttgcaccgtgggaaaaaggttggtacggaacgcatctgg
tatggcgataaagaaaatatcgccctgggaacggaacaagagttctggatggtgctaccg
aaagccgaaattccacatatcaaagccaaatatacccttgatggtaaagaactcaccgcg
ccaattagcgcccatcagcgggtaggggaaattgaactttacgaccgtgataaacaggtg
gcgcactggccgctggttaccctggaatctgtcggggaaggcagcatgttttcccggctg
agtgattatttccaccataaggcctga

DBGET integrated database retrieval system