KEGG   Escherichia coli O7 K1 CE10: CE10_2405
Entry
CE10_2405         CDS       T01999                                 

Gene name
gatD
Definition
(GenBank) galactitol-1-phosphate dehydrogenase, Zn-dependent and NAD(P)-binding protein
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
eoc  Escherichia coli O7:K1 CE10
Pathway
eoc00052  Galactose metabolism
eoc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eoc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CE10_2405 (gatD)
Enzymes [BR:eoc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     CE10_2405 (gatD)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 3HCDH_N 2-Hacid_dh_C Shikimate_DH UDPG_MGDP_dh_N Methyltransf_25 PrmA ELFV_dehydrog FAD_binding_2 TrkA_N
Other DBs
NCBI-ProteinID: AEQ13179
UniProt: A0A0E0V6L8
LinkDB
Structure
PDB: 
4UEJ 4A2C 4UEK 4UEO

Position
complement(2434935..2435975)
AA seq 346 aa
MKSVVNDTDGIVRVAESVIPEIKHQDEVRVKIASSGLCGSDLPRIFKNGAHYYPITLGHE
FSGYIDAVGSGVDDLHPGDAVACVPLLPCFTCPECLKGFYSQCAKYDFIGSRRDGGFAEY
IVVKRKNVFALPADMPIEDGAFIEPITVGLHAFHLAQGCENKNVIIIGAGTIGLLAIQCA
VALGAKSVTAIDISSEKLALAKSFGAMQTFNSREMSAPQIQGVLRELRFNQLILETAGVP
QTVELAVEIAGPHAQLALVGTLHQDLHLTSATFGKILRKELTVIGSWMNYSSPWPGQEWE
TASRLLTERKLSLEPLIAHRGSFECFAQAVRDIARNAMPGKVLLIP
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgaaatcagtggtgaatgatactgatggtatcgtgcgcgttgcagaaagcgtcattcct
gaaattaaacatcaggatgaggtgcgggtaaaaattgccagctcgggcttatgtggttcc
gatttacccaggatatttaaaaatggtgcacattattatccaataacgttagggcatgaa
tttagcggctatattgatgcggtgggatccggtgttgatgatttacaccccggcgatgcg
gttgcctgtgtaccgttattaccctgttttacttgtccagagtgtttgaaagggttttat
tcccagtgcgcaaaatatgattttattggctcgcggcgtgatggtggatttgctgaatat
attgtcgttaagcgaaaaaatgtctttgctctacctgcggatatgcctattgaggatggc
gcttttattgaaccgattaccgttggcctgcatgcgttccatttagcgcaaggatgtgag
aataaaaacgttattattattggtgccggaaccattggcctgctggcaattcagtgcgct
gtcgcgctgggagcaaagagtgtgacggctatcgacattagctcagaaaaactggcactg
gcaaaatctttcggtgcgatgcaaacatttaacagccgtgaaatgagcgcgccgcaaata
cagggcgttttacgcgagctgcgctttaatcagcttatcctcgagacggctggcgtcccg
caaaccgtcgaactggcggtagagattgccggtcctcatgcccaactggcgctggtaggc
acgttgcatcaggatctgcatttaacatcggcaacgtttggcaaaatattgcgtaaagag
ctgacggttatcggcagttggatgaactactccagcccttggccggggcaggagtgggaa
acggcgagccggttgctgacagaacgtaagttaagcctggagccattaatcgctcaccgt
ggaagctttgaatgcttcgcccaggcggtgcgtgacatcgctcgtaatgctatgccgggc
aaagtgttgctcattccctga

DBGET integrated database retrieval system