KEGG   Escherichia coli O7 K1 CE10: CE10_3080Help
Entry
CE10_3080         CDS       T01999                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase, PLP-dependent
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
eoc  Escherichia coli O7:K1 CE10
Pathway
eoc00250  Alanine, aspartate and glutamate metabolism
eoc00280  Valine, leucine and isoleucine degradation
eoc00310  Lysine degradation
eoc00410  beta-Alanine metabolism
eoc00640  Propanoate metabolism
eoc00650  Butanoate metabolism
eoc01100  Metabolic pathways
eoc01120  Microbial metabolism in diverse environments
Module
eoc_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:eoc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CE10_3080 (gabT)
   00650 Butanoate metabolism
    CE10_3080 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CE10_3080 (gabT)
   00280 Valine, leucine and isoleucine degradation
    CE10_3080 (gabT)
   00310 Lysine degradation
    CE10_3080 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CE10_3080 (gabT)
Enzymes [BR:eoc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CE10_3080 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     CE10_3080 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     CE10_3080 (gabT)
Amino acid related enzymes [BR:eoc01007]
 Aminotransferase (transaminase)
  Class III
   CE10_3080 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AEQ13822
UniProt: A0A0E0V8C0
LinkDB All DBs
Structure
PDB: 

Position
3144692..3145972
Genome map
AA seq 426 aa AA seqDB search
MSSNKELMQRRSQAVPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
KVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISE
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAATPAFMLRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAG
NPIACVAALEVLKVFEQENLLQKANVLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELF
EDGDPSKPDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIISQC
FAEAKL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaataaagagttaatgcagcgccgtagtcaggcagttcctcgtggcgttggg
caaattcacccgattttcgctgaccgcgcggaaaactgccgggtgtgggacgttgaaggc
cgtgagtatcttgatttcgcgggcgggattgcggtgctcaataccgggcacctgcatccg
aaagtggtggcggcagtggaagcgcagttgaaaaaactgtcgcacacctgcttccaggtg
ctggcttacgagccgtatctggagctgtgcgagattatgaatcagaaggtgccgggcgat
tttgccaagaaaacgctgctggtcaccacgggttctgaagcggtggaaaacgcagtgaaa
atcgcccgcgccgccaccaaacgcagcgggaccatcgcctttagcggcgcgtatcacggg
cgcacgcactatacactagcgctgactggcaaggtgaatccgtactctgcggggatgggg
ctgatgccggggcatgtttatcgcgcgctttatccttgcccgctgcatggcatcagtgaa
gatgacgctatcgccagtatccaccgaatcttcaaaaatgacgcggcgccggaagatatc
gccgccatcgtgattgagccggttcagggcgaaggtggtttctacgccgcaacaccagcc
tttatgctgcgtttacgcgcgctgtgtgacgaacacgggatcatgctgattgccgatgaa
gtgcagagcggcgcggggcgtaccggcacgctgtttgcgatggagcagatgggcgtggcg
ccggatctcaccacctttgcgaaatcgatcgcaggcggcttcccgctggcgggcgtcacc
gggcgtgccgaagtgatggacgctgtcgctccaggcggactgggtggcacctatgccggt
aacccgattgcctgcgtagcggcgctggaagtgttgaaggtgttcgagcaggaaaatctg
ctgcaaaaagccaacgttctggggcagaagctgaaagacggattgctggcgatcgccgaa
aaacacccggagatcggcgacgtacgcgggctgggggcgatgatcgccatcgagctgttt
gaagatggcgatcccagcaaaccggacgcaaaactcaccgccgagatcgtggcacgcgcc
cgcgataagggtctgattcttctctcctgcggcccgtattacaacgtgctgcgcatcctt
gtaccgctcaccattgaagacgctcagatccgtcagggtctggagatcatcagccagtgt
tttgctgaggcgaagctgtag

DBGET integrated database retrieval system