KEGG   Escherichia coli O7 K1 CE10: CE10_3946Help
Entry
CE10_3946         CDS       T01999                                 

Gene name
glpD
Definition
(GenBank) sn-glycerol-3-phosphate dehydrogenase, aerobic, FAD/NAD(P)-binding protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
eoc  Escherichia coli O7:K1 CE10
Pathway
eoc00564  Glycerophospholipid metabolism
eoc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eoc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CE10_3946 (glpD)
Enzymes [BR:eoc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CE10_3946 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored Pyr_redox_2 NAD_binding_8 3HCDH_N FAD_binding_2 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AEQ14655
UniProt: A0A0E0VC43
LinkDB All DBs
Structure
PDB: 

Position
4003097..4004602
Genome map
AA seq 501 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRISLPGS
TGLRFGANSVLKPEIKRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATSARRENG
LWIVEAEDIDTGKKYTWQARGLVNATGPWVKQFFDEGMHLPSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVKIEESEINYLLKVYNTHF
KKQLSRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKLTTYRK
LAEHALEKLTPYYQSIGPAWTKESVLPGGAIEGDRDDYAARLRRRYPFLTESLARHYART
YGSNSELLLGNAGAISDLGEDFGHEFYEAELKYLVDHEWVRRADDALWRRTKQGMWLNAD
QQSRVSQWLVEYTQQKLSLAS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagatctgattgtgataggtggcggcatcaatggtgctggtatcgcggca
gacgccgctggacgcggtttatccgtgctgatgctggaggcgcaggatctcgcttgcgcg
acctcttccgccagttcaaaactcattcacggtggcctgcgctaccttgagcactatgaa
ttccgcctggtcagcgaggcgctggctgaacgtgaagtgttgctgaaaatggctccgcat
atcgccttcccgatgcgttttcgcctgccacatcgtccgcatctgcgcccggcgtggatg
attcgcattggtctgtttatgtacgatcatctgggtaaacgcatcagcctgccgggatca
accggtttgcgttttggcgcaaactcagtgttaaaaccggaaattaagcgcggattcgaa
tattctgactgttgggtagacgacgcccgtctggtactcgccaacgcccagatggtggta
cgtaaaggcggtgaagtgcttactcgtactcgtgccacttctgctcgccgcgaaaacggc
ctgtggattgtggaagcagaagatatcgataccggcaaaaaatacacctggcaggcgcgc
ggcctggtgaacgccaccggcccgtgggtgaaacagttcttcgacgaggggatgcatctg
ccttcgccttatggcattcgcctgatcaaaggcagccatattgtggtgccacgcgtgcat
acccagaagcaagcctacattctgcaaaacgaagataaacgtattgtgttcgtgatcccg
tggatggacgagttttccatcatcggcaccaccgatgtggaatacaaaggtgatccgaaa
gccgtgaagattgaagagagtgaaatcaattacctgctgaaagtgtataacacgcacttt
aaaaagcagttaagccgtgacgatatcgtctggacttactccggcgtgcgtccgctgtgt
gatgatgagtccgactcgccgcaggcaattacccgtgattacacccttgatatccatgac
gaaaacggcaaagcaccgctgctgtcggtattcggcggtaagctgaccacctaccgcaaa
ctggcggaacatgcgctggaaaaactgacgccgtattatcagagtattggcccggcgtgg
acgaaagagagcgtgctgccgggaggtgccattgaaggcgaccgcgacgattacgccgct
cgcctgcgccgccgttacccgttcctgactgaatcgctggcacgtcactacgcacgcact
tacggcagcaacagcgaactgctgctcggcaatgcgggggcgataagcgacctcggggag
gatttcggtcatgagttctacgaagcggaactgaaatacctggtggatcacgaatgggtc
cgtcgcgccgacgatgccctgtggcgtcgcacaaaacaaggcatgtggctaaatgcggat
caacaatctcgtgtgagtcagtggctggtggagtatacgcagcagaagttgtcgctggcg
tcgtaa

DBGET integrated database retrieval system