KEGG   Escherichia coli O7 K1 CE10: CE10_4024Help
Entry
CE10_4024         CDS       T01999                                 

Gene name
uspB
Definition
(GenBank) universal stress (ethanol tolerance) protein B
  KO
K06144  universal stress protein B
Organism
eoc  Escherichia coli O7:K1 CE10
Brite
KEGG Orthology (KO) [BR:eoc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eoc02000]
    CE10_4024 (uspB)
Transporters [BR:eoc02000]
 Other transporters
  Others
   CE10_4024 (uspB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UspB
Motif
Other DBs
NCBI-ProteinID: AEQ14733
UniProt: A0A0E0VBZ2
LinkDB All DBs
Position
complement(4087912..4088247)
Genome map
AA seq 111 aa AA seqDB search
MISTVALFWALCVVCIVNMARYFSSLRALLVVLRNCDPLLYQYVDGGGFFTSHGQPNKQV
RLVWYIYAQRYRDHHDDEFIRRCERVRRQFILTSALCGLVVVSLIALMIWH
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgataagcaccgtcgcattattttgggctttatgtgtcgtttgcattgttaacatggcg
cgctatttctcatcactacgcgcgttgttagtggtactgcgtaactgcgatccattgctc
tatcaatatgttgatggagggggcttttttacctcacatggccaacccaacaaacaggtg
cgtctcgtttggtatatctatgcccaacgttatcgcgatcatcacgatgatgagtttatt
cgccgctgtgagcgggtgcgtcggcagtttattctgaccagcgcattgtgtggtctggtg
gtggtcagcctgattgcattgatgatttggcattaa

DBGET integrated database retrieval system