KEGG   Escherichia coli O7 K1 CE10: CE10_4176Help
Entry
CE10_4176         CDS       T01999                                 

Gene name
tdh
Definition
(GenBank) threonine 3-dehydrogenase, NAD(P)-binding protein
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
eoc  Escherichia coli O7:K1 CE10
Pathway
eoc00260  Glycine, serine and threonine metabolism
eoc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eoc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CE10_4176 (tdh)
Enzymes [BR:eoc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     CE10_4176 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C FAD_binding_3 HI0933_like FAD_binding_2 FAD_oxidored Pyr_redox_3 Pyr_redox_2 Methyltransf_25 Methyltransf_16 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AEQ14880
UniProt: A0A0E0VCQ9
LinkDB All DBs
Position
complement(4252409..4253434)
Genome map
AA seq 341 aa AA seqDB search
MKALSKLKAEEGIWMTDVPVPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKTIPVPMV
VGHEYVGEVVGIGQEVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGC
FAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDLVGEDVLVSGAGPIGIMAA
AVAKHVGARNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMTELGMTEGFDVGLEMS
GAPPAFRTMLDTMNHGGRIAMLGIPPSDMSIDWTKVIFKGLFIKGIYGREMFETWYKMAA
LIQSGLDLSPIITHRFSIDDFQKGFDAMRSGQSGKVILSWD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgttatccaaactgaaagcggaagagggcatctggatgaccgacgttcctgta
ccggaactcgggcataacgatctgctgattaaaatccgtaaaacagccatctgcgggact
gacgttcacatctataactgggatgagtggtcgcaaaaaaccatcccggtgccgatggtc
gtgggccatgaatatgtcggtgaagtggtaggtattggtcaggaagtgaaaggcttcaag
attggcgatcgcgtttctggcgaaggccatatcacctgcggtcactgtcgcaactgtcgt
ggcggtcgtacccatctgtgccgcaacacgatcggcgtcggcgttaaccgtccgggctgc
tttgccgagtatctggtgattccggcgttcaacgctttcaaaatccccgacaatatctcc
gatgatctggcttccatttttgatcccttcggtaacgccgtgcataccgcgctgtcgttt
gatctggtgggcgaggatgtgctggtctctggtgcaggcccgattggtattatggcggcg
gcggtggcgaaacacgttggtgcacgtaacgtggtgattactgatgttaacgaataccgc
cttgagctggcgcgtaaaatgggtatcacccgtgcggttaacgtcgcgaaagaaaacctt
aatgatgtgatgacagaactgggcatgaccgaaggctttgatgtcggtctggaaatgtcc
ggtgcgccgccagcgtttcgtaccatgctcgacaccatgaaccacggcggtcgtattgcg
atgctgggtattccaccgtccgatatgtctatcgactggaccaaagtaatctttaaaggc
ttgttcattaaaggtatttacggtcgtgagatgtttgaaacctggtacaagatggcggcg
ctgattcagtctggcctcgatctctcgccgatcattacccatcgtttctctatcgatgat
ttccagaagggctttgacgctatgcgttcgggccagtccgggaaagttattctgagctgg
gattaa

DBGET integrated database retrieval system