KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_1122Help
Entry
ECO103_1122       CDS       T01096                                 

Gene name
flgF
Definition
(GenBank) flagellar component FlgF of cell-proximal portion of basal-body rod
  KO
K02391  flagellar basal-body rod protein FlgF
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
Pathway
eoh02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:eoh00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    ECO103_1122 (flgF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:eoh02035]
    ECO103_1122 (flgF)
Bacterial motility proteins [BR:eoh02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    ECO103_1122 (flgF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flg_bbr_C Flg_bb_rod
Motif
Other DBs
NCBI-ProteinID: BAI29961
LinkDB All DBs
Position
1218544..1219299
Genome map
AA seq 251 aa AA seqDB search
MDHAIYTAMGAASQTLNQQAVTASNLANASTPGFRAQLNALRAVPVEGLSLPTRTLVTAS
TPGADMTPGKMDYTSRPLDVALQQDGWLAVQSADGSEGYTRNGSIQVDPTGQLTIQGHPV
IGEAGPIAVPEGAEITIAADGTISALNPGDPANTVAPVGRLKLVKATGSEVQRGDDGIFR
LSAESQATRGPILQADPTLRVMSGVLEGSNVNAVAAMSDMIASARRFEMQMKVISSVDDN
AGRANQLLSMS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggatcacgcaatttataccgcgatgggagcagccagccagacgctgaatcaacaggcg
gtaaccgccagtaatctggccaatgcctctacgcccggttttcgcgcgcagttaaacgcc
ttgcgtgcagtgccggtggaagggctttcactgcccacgcgcacgctggtaacggcgtca
acaccgggtgcagacatgacgcccggcaagatggattacacctcgcgcccgctggacgtt
gcattgcagcaggatggctggctggccgtgcagtccgctgacggcagcgaagggtatacg
cgtaatggcagcattcaggttgatcccaccgggcaactgacaattcaggggcatccggtg
ataggcgaggctgggccaattgctgtgccggaaggggcggaaatcactattgctgccgat
ggcacaatctcggcgctcaatccgggcgatccggcaaatacggttgcgccagtggggcgt
ctgaaactggtgaaagccacgggcagcgaagtgcaacgcggtgacgacggcatttttcgt
ttaagcgcagaaagccaggccacgcgtgggccgatactgcaggcagatccaaccttgcgt
gtgatgtcgggggttctggaaggcagtaacgtcaatgccgttgcggcaatgagcgacatg
attgccagcgcgcggcgttttgaaatgcagatgaaggtgatcagcagcgtcgatgataac
gcaggccgtgccaaccaactgctgtcgatgagttaa

DBGET integrated database retrieval system