KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_1227Help
Entry
ECO103_1227       CDS       T01096                                 

Definition
(GenBank) putative side tail fiber protein
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: phage_tail_N Phage_fiber_C Collagen CarboxypepD_reg Borrelia_P83
Motif
Other DBs
NCBI-ProteinID: BAI30063
LinkDB All DBs
Position
1310836..1312149
Genome map
AA seq 437 aa AA seqDB search
MAVKISGVLKDGTGKPVENCTIQLKARRTSSTVVVNTVASENPDEAGRYTMDVEYGQYSV
ILLVEGFPPSHAGTITVYEDSQPGTLNDFLGAMSEDDVRPEALRRFELMVEEAARHAEEA
KKNAGEAETSARNAGISASQAEESAANADTSAGEASESARQAAESAAAAKQSEEASSSSA
SAAAQKASESSQSAAEAELSRKTAESAAGNAARDATTATEKARESAESAQSAEQSRIAAE
EAVNRIPTVVGPPGPKGEPGPAGPQGPKGDKGERGDTGPAGATGERGPRGDTGPAGPQGP
KGDRGERGETGLTGDAGPQGPKGDTGAAGPAGPQGPKGETGAAGPVGATGPQGPKGDPGE
TQIRFRLGPASIIETNSNGWFPDTDGALITGLTFLDPKDATRVQGFFQHLQVRFGDGPWQ
DVKGLDEVGSDTGRTGE
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaaagatttcaggtgtactgaaagacggcacaggaaaaccggtagagaactgc
accattcaactgaaagccagacggaccagcagcacggtggtggtgaacacggtggcttca
gaaaacccggatgaagccgggcgttacacaatggacgttgagtacggtcagtacagcgtc
attctgttggtggaaggattcccgccgtcacatgccgggaccatcaccgtgtatgaagat
tctcaaccggggacgctgaatgattttctcggtgccatgtcggaggatgacgtccggccg
gaggcactgcgtcgttttgaactgatggtggaagaagcggcgcgtcacgctgaggaggcg
aagaagaatgccggagaggcggagacgtcagcgaggaatgccggcatatcagccagtcag
gcagaagagagcgctgcaaatgctgacacttcagcaggggaggcatcggagtcagcccgg
caggcggcagaaagtgcagccgctgcaaagcagtcagaggaagcgtcctcgtcctcggcc
tctgcggccgctcaaaaagccagtgagtcatcacaaagtgcagcagaagctgaattgtca
agaaagacggcagaaagtgcagccggtaatgcagccagggatgcaacgaccgcaacagaa
aaagcccgggagtcagcagaaagcgcacagtcagcggaacaaagcaggatagcggcggaa
gaggccgtaaaccgaatccccaccgtggtggggcctcccgggccaaagggggaaccgggt
cccgcgggtcctcaggggccgaagggggataagggagagcgtggcgacaccggcccggca
ggggcaaccggtgaaagggggccgagaggagatactggtccggcaggcccgcaggggccg
aaaggcgacaggggagagcggggagagaccggtctgacgggagatgcaggtccacagggt
ccaaagggagataccggtgcggcaggcccggcaggcccacagggaccgaaaggagaaaca
ggtgcggctggcccggtgggggcaaccggacctcagggaccgaagggcgacccgggggag
acacaaatccgttttcgtctggggccggcgagcattattgagacaaacagcaatggctgg
ttcccggatacagatggcgcactcatcaccggactgacctttcttgaccccaaagatgcc
acacgggttcagggtttttttcagcatttgcaggtcagatttggcgacgggccgtggcag
gatgtcaaggggctggatgaagtgggcagtgatacaggcagaacaggagaatga

DBGET integrated database retrieval system