KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_1426Help
Entry
ECO103_1426       CDS       T01096                                 

Gene name
trpE
Definition
(GenBank) component I of anthranilate synthase
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
Pathway
eoh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eoh01100  Metabolic pathways
eoh01110  Biosynthesis of secondary metabolites
eoh01130  Biosynthesis of antibiotics
eoh01230  Biosynthesis of amino acids
eoh02024  Quorum sensing
Module
eoh_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eoh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ECO103_1426 (trpE)
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    ECO103_1426 (trpE)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ECO103_1426 (trpE)
Enzymes [BR:eoh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     ECO103_1426 (trpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N HalX Flg_hook
Motif
Other DBs
NCBI-ProteinID: BAI30256
LinkDB All DBs
Position
complement(1498279..1499841)
Genome map
AA seq 520 aa AA seqDB search
MQTQKPTLELLTCEGAYRDNPTALFHQLCGDRPATLLLESADIDSKDDLKSLLLVDSALR
ITALGDTVTIQALSGNGEALLTLLDNALPAGVENEQLPNCRVLRFPPVSPLLDEDARLCS
LSVFDAFRLLQNLLNVPKEEREAMFFGGLFSYDLVAGFEDLPQLSAENNCPDFCFYLAET
LMVIDHQKKSTRIQASLFAPNEEEKQRLTARLNELRQQLTEAAPPLPVVSVPHMRCECNQ
SDEEFGGVVRLLQKAIRAGEIFQVVPSRRFSLPCPSPLAAYYVLKKSNPSPYMFFMQDND
FTLFGASPESSLKYDATSRQIEIYPIAGTRPRGRRADGSLDRDLDSRIELEMRTDHKELS
EHLMLVDLARNDLARICTPGSRYVADLTKVDRYSYVMHLVSRVVGELRHDLDALHAYRAC
MNMGTLSGAPKVRAMQLIAEAEGRRRGSYGGAVGYFTAHGDLDTCIVIRSALVENGIATV
QAGAGVVLDSVPQSEADETRNKARAVLRAIATAHHAQETF
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacacaaaaaccgactctcgaactgctaacctgcgaaggcgcttatcgcgacaat
cccaccgcgctttttcaccagttgtgtggggatcgtccggcaacgctgctgctggaatcc
gcagatatcgacagcaaagatgatttaaaaagcctgctgctggtagacagtgcgctgcgc
attacagctttaggtgacactgtcacaatccaggcactttccggcaacggcgaagccctg
ctgacactactggataacgccctgcctgcgggtgtggaaaatgaacaattaccaaactgc
cgtgtgctgcgcttcccccctgtcagtccactgctggatgaagacgctcgcttatgctcc
ctttcggtttttgacgctttccgtttattgcagaatctgttgaatgtaccgaaggaagaa
cgagaagcaatgttcttcggcggcctgttctcttatgaccttgtggcgggatttgaagat
ttaccgcaactgtcagcggaaaataactgccctgatttctgtttttatctcgctgaaact
ctgatggtgattgaccatcagaaaaaaagcacccgtattcaggccagcctgtttgctccg
aatgaagaagaaaaacaacgtctcactgctcgcctgaacgaactacgtcagcaactgacc
gaagccgcgccgccgctgccagtggtttccgtgccgcatatgcgttgtgaatgtaatcag
agcgatgaagagttcggtggcgtagtgcgtttgttgcaaaaagcgattcgcgctggagaa
attttccaggtggtgccatctcgccgtttctctctgccctgcccgtcaccgctggcggcc
tattacgtgctgaaaaagagtaatcccagcccgtacatgttttttatgcaggataatgat
ttcaccctgtttggcgcgtcgccggaaagttcgctcaagtatgacgccaccagccgccag
attgagatctacccgattgccggaacacgtccacgcggtcgtcgtgccgatggctcgctg
gacagagacctcgacagccgcatcgaactggaaatgcgtaccgatcataaagagctttct
gaacatctgatgctggtggatctcgcccgtaatgatctggcacgcatttgcacccccggc
agccgctacgtcgccgacctcaccaaagttgaccgttactcttacgtgatgcacttggtc
tcccgcgtggtcggtgagctgcgccacgatctcgacgccctgcacgcttaccgcgcctgt
atgaatatgggaacgttaagtggtgcgccgaaagtacgcgctatgcagttaattgccgag
gcggaaggtcgccgccgcggcagctacggcggcgcggtaggttatttcaccgcgcatggc
gatctcgacacctgcattgtgatccgctcggcgctggtggaaaacggtatcgccaccgtg
caagccggtgctggcgtagtccttgattctgttccgcagtcggaagccgacgaaacccgt
aataaagcccgcgctgtactgcgcgctattgccaccgcgcatcatgcacaggagactttc
tga

DBGET integrated database retrieval system