KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_1600Help
Entry
ECO103_1600       CDS       T01096                                 

Definition
(GenBank) T3SS effector-like protein EspR-homolog
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LRR_4 LRR_8 LRR_9 LRR_6
Motif
Other DBs
NCBI-ProteinID: BAI30422
UniProt: C8U8E4
LinkDB All DBs
Position
complement(1692103..1693434)
Genome map
AA seq 443 aa AA seqDB search
MITDLILHNNPRMKTITLNDNHIAHLNAKNTTELEYLNLSNNNLLPTNDIDQLISSKHLW
HVLVNGINNDPLAQMQYWTAVRNIIDDTNEVTIDLSGLNLTTQPPGLQNFTSINLDNNQL
THFDATNYDRLVKLSLNSNTLESINFPQGRNVSITHISMNNNALRNIDIDRLSSVTYFSA
AHNQLEFVQLESCEWLQYLNLSHNQLTDIVAGNKNELLLLDLSHNKLTSLHNDLFPNLNT
LLINNNLLSEIKIFYSNFCNVQTLNAANNQLKYINLDFLTYLPSIKSLRLDNNKITHIDT
NNTSDIGTLFPIIKQSKNLNFLNVSGKNNCPTMQLMLFNLFSPALKLNTGLAILSPGAFE
VHSDGIDVDNELFHYPIKKAYTPYNIHTYKTEEVVNQRNIKVKNMTLDEINNTYCNNDYY
NQAIREEPIDLLDRSFSSSSWPF
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgatcactgaccttatattacacaataatcccaggatgaaaacaatcactttaaacgac
aaccatattgcacatttaaacgccaaaaacactacagaactggaatatttaaacttaagc
aataacaatttactgccaaccaatgacattgatcaactaatatcatcaaaacatctttgg
catgtattagttaacggcatcaacaatgatccacttgcacaaatgcagtactggactgca
gtaagaaatataattgatgacactaatgaagtgaccattgatttatcaggacttaattta
accactcaaccaccagggctgcaaaacttcacctctatcaatcttgataataaccaactc
acacattttgatgcaaccaactacgatagactcgtaaagctaagtctgaatagtaatact
cttgagtcaataaattttcctcaaggcagaaatgtaagtattacacatatatctatgaat
aataatgctctcagaaatattgatatagataggctttcatcagttacttattttagtgcg
gcacataatcaactagagtttgtgcaattagaatcttgcgaatggctgcaatacctgaat
ctcagccataatcaattaactgatattgttgcaggtaataaaaatgaactcttactgctg
gatctatcccataataaactaacaagtttacacaatgacttatttcccaacttgaatacg
ttacttattaacaacaatttgctttctgaaattaaaatattctatagcaacttctgcaat
gttcagacattaaacgctgctaacaaccagttgaaatatataaatcttgatttcctgact
tatcttccatctatcaaaagtttaagactggacaataataaaataacccacattgatact
aataatacatccgatattggaactttattccccataataaaacagagcaaaaacttaaat
tttttaaatgtttctgggaagaacaattgccctactatgcagctcatgttatttaatttg
ttttccccagcacttaagcttaatactggcctggcaattctttcgcctggtgcatttgaa
gttcactctgacggaatagatgtggataacgaattgtttcactatcctattaaaaaagca
tataccccatataatatacacacttacaagacagaggaagttgtaaaccagaggaatata
aaagttaaaaacatgaccttagatgaaataaacaatacttactgtaataacgattattac
aatcaggcaataagagaggaaccgatagaccttctggacagatcgttttcctccagttca
tggcctttttag

DBGET integrated database retrieval system